IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ park-2006a-5 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag immunost anti tag immunostaining anti tag immunost Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation park-2006a-2 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation park-2006a-3 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. human-t1 Homo sapiens lymphoid cell line T1 t1 human lymphoid cell line T1 http://www.lgcpromochem.com/atcc/ anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation park-2006a-4 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation park-2006a-1 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Park B., Lee S., Kim E., Cho K., Riddell SR., Cho S., Ahn K. Anti-TAP1 immunoprecipitates were reprecipitated from digitonin lysates of radiolabled HeLa cells with specific antibodies. ksahn@snu.ac.kr Cell (0092-8674) 2006 Only protein-protein interactions 18 imex curation tap1_human Antigen peptide transporter 1 ABCB2 PSF1 RING4 Y3 TAP1 Peptide transporter TAP1 ATP-binding cassette sub-family B member 2 Peptide supply factor 1 Peptide transporter PSF1 Peptide transporter involved in antigen processing 1 Really interesting new gene 4 protein protein protein human Homo sapiens Human MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE ilmekihkv_peptide ILMEKIHKV high-affinity peptide for HLA-A2.1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ILMEKIHKV An amino acid sequence which is not represented in UniProt idmekihk_peptide IDMEKIHK low-affinity peptide for HLA-A2.1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) IDMEKIHK An amino acid sequence which is not represented in UniProt tap2_human Antigen peptide transporter 2 ATP-binding cassette sub-family B member 3 Peptide transporter TAP2 Peptide supply factor 2 Peptide transporter PSF2 Peptide transporter involved in antigen processing 2 TAP2 ABCB3 PSF2 RING11 Y1 Really interesting new gene 11 protein protein protein human Homo sapiens Human MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL pdia1_human Protein disulfide-isomerase P4HB PDI PDIA1 PO4DB Prolyl 4-hydroxylase subunit beta Cellular thyroid hormone-binding protein p55 ERBA2L protein protein human Homo sapiens Human MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE calr_human Calreticulin CRP55 Calregulin HACBP Endoplasmic reticulum resident protein 60 grp60 CALR CRTC protein protein human Homo sapiens Human MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL pdia3_human Protein disulfide-isomerase A3 Disulfide isomerase ER-60 Endoplasmic reticulum resident protein 60 58 kDa microsomal protein Endoplasmic reticulum resident protein 57 58 kDa glucose-regulated protein PDIA3 ERP60 GRP58 ERP57 protein protein human Homo sapiens Human MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM tap1-ilmekihkv High-affinity peptide for HLA-A2.1 coimmunoprecipitates with TAP1 569785 n/a 569790 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 569791 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false S2 A tap1-idmekihk Low-affinity peptide for HLA-A2.1 coimmunoprecipitates with TAP1 569785 N/A 569792 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 569790 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false S2 A tap2-ilmekihkv High-affinity peptide for HLA-A2.1 coimmunoprecipitates with TAP2 569785 N/A 569793 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 569791 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false S2 A tap2-idmekihk Low-affinity peptide for HLA-A2.1 coimmunoprecipitates with TAP2 569785 N/A 569792 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 569793 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false S2 A p4hb-ilmekihkv High-affinity peptide for HLA-A2.1 coimmunoprecipitates with PDI 569785 N/A 569794 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 569791 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false S2 B This result suggests that the b' domain of PDI binds the peptide. p4hb-idmekihk Low-affinity peptide for HLA-A2.1 coimmunoprecipitates with PDI 569785 N/A 569794 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind range range range range false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 569792 unspecified role unspecified role prey prey n-terminal biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false S2 B This result suggests that the b' domain of PDI binds the peptide. tap1-tap2 569786 n/a 569790 unspecified role unspecified role bait bait N/A 569793 unspecified role unspecified role prey prey physical association physical association false false false 1 B tap1-tapbp 569786 N/A 569795 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait physical association physical association false false false 1 B, S1 tap1-calr 569786 n/a 569790 unspecified role unspecified role bait bait N/A 569796 unspecified role unspecified role prey prey physical association physical association false false false 1 B tap1-pd1a3 569786 N/A 569797 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait physical association physical association false false false 1 B, S1 tap1-p4hb 569786 N/A 569794 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait physical association physical association false false false 1 B, S1 tap1-pd1a3-1 569787 N/A 569797 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait physical association physical association false false false S1 tap1-p4hb-1 569787 n/a 569790 unspecified role unspecified role bait bait N/A 569794 unspecified role unspecified role prey prey physical association physical association false false false S1 tap1-tapbp-1 569787 N/A 569795 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait physical association physical association false false false S1 tap1-pd1a3-2 569788 N/A 569797 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait physical association physical association false false false S1 tap1-p4hb-2 569788 n/a 569790 unspecified role unspecified role bait bait N/A 569794 unspecified role unspecified role prey prey physical association physical association false false false S1 tap1-tapbp-3 569788 n/a 569790 unspecified role unspecified role bait bait N/A 569795 unspecified role unspecified role prey prey physical association physical association false false false S1 tap1-b2m 569789 N/A 569795 unspecified role unspecified role prey prey N/A 569797 unspecified role unspecified role prey prey n/a 569790 unspecified role unspecified role bait bait N/A 569796 unspecified role unspecified role prey prey N/A 569798 unspecified role unspecified role prey prey N/A 569794 unspecified role unspecified role prey prey N/A 569793 unspecified role unspecified role prey prey association association false false false 1 A Some of the proteins precipiated with TAP1 could not be added as interactors (MHC class I heavy chain, Ig gamma H-chain, light chain).