IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ morello-2006-2 CRTAP is required for prolyl 3- hydroxylation and mutations cause recessive osteogenesis imperfecta. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Morello R., Bertin TK., Chen Y., Hicks J., Tonachini L., Monticone M., Castagnola P., Rauch F., Glorieux FH., Vranka J., Bachinger HP., Pace JM., Schwarze U., Byers PH., Weis M., Fernandes RJ., Eyre DR., Yao Z., Boyce BF., Lee B. Proteins were identified on the basis of molecular mass. Proteins derived from 15 day-old chick embryo rER extracts eluted from the gelatin Sepharose column were labeled with 14C-formaldehyde and subjected to velocity sedimentation on a sucrose gradient. The sucrose gradient was fractionated and samples analyzed on SDS-polyacrylamide gels. Proteins were then detected and quantified by fluorography. The complex was isolated and its molecular mass was determined by laser-light-scattering blee@bcm.tmc.edu Cell (0092-8674) 2006 Only protein-protein interactions 3 imex curation morello-2006-1 CRTAP is required for prolyl 3- hydroxylation and mutations cause recessive osteogenesis imperfecta. in vitro In vitro cosedimentation cosedimentation weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Morello R., Bertin TK., Chen Y., Hicks J., Tonachini L., Monticone M., Castagnola P., Rauch F., Glorieux FH., Vranka J., Bachinger HP., Pace JM., Schwarze U., Byers PH., Weis M., Fernandes RJ., Eyre DR., Yao Z., Boyce BF., Lee B. Proteins were identified on the basis of molecular mass. Proteins derived from 15 day-old chick embryo rER extracts eluted from the gelatin Sepharose column were labeled with 14C-formaldehyde and subjected to velocity sedimentation on a sucrose gradient. The sucrose gradient was fractionated and samples analyzed on SDS-polyacrylamide gels. Proteins were then detected and quantified by fluorography. The complex was isolated and its molecular mass was determined by laser-light-scattering blee@bcm.tmc.edu Cell (0092-8674) 2006 Only protein-protein interactions 3 imex curation crtap_chick Cartilage-associated protein Dualin CRTAP CASP protein protein chick Gallus gallus (Chicken) Chicken MWRTLLAALLATAGAQYERYSFRSFPRDELMPLESAYRYGLDQYSTENWPESVSYLEVSMRLYRLLRDTEAFCHHNCSSAGPLTAPPPADGELAELRLLAGVLRRAQCLRRCKQGLPAFRQAQPGRELLEEFQRREPYKYLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMQRNMAYYKSIPDAEEHIKDLETKPYENLFVRAVRAYNGDNWRTSISDMELALPDFFKTYDDCIAACEGSREIKDFKDFYLSIADHYIEVLACKVQFDITT p3h1_chick Prolyl 3-hydroxylase 1 P3H1 LEPRE1 Leucine- and proline-enriched proteoglycan 1 homolog protein protein chick Gallus gallus (Chicken) Chicken MALLLPLLPLLVWAAGPPGPLGPPEHSEPPLPAEPPDALFAAGAEAYARGDWPAVVLQMERALRARAAIRARSVRCRLRCANATAVVPTDGLEPTLHDLLFFRGLLRRAACLRGCGPTQPSRYRLGEELEREFRKRSPYNYLQVAYFKINKVAKAVAAAHTFFVANPEHVEMKQNLEYYQMMAGVRESDFADLEARPHMTEFRLGVRFYSEEQPAAAVLHLEKALQEYFVADTECRALCEGPYDYEGYNYLEYNADLFQAMTDHYMQVLSCKQGCVTELASQPGREKPLEDFLPSHFNYLQFAYYNNGNYEKAIECAKTYLLFFPNDEVMNQNLAYYTAVLGEDLARPIEPRKEIQAYRQRSLMEKELLFFSYDVFGIPFVDPDTWTPEEVIPKRLREKQKVERETAARISEEIGNLMKEIETLVEEKAKESAEMSKFIREGGPLVYEGASVTMNSKSLNGSQRVVVDGVLSAEECRELQRLTNAAASAGDGYRGKTSPHTPSETFYGVTVLKALKLGQEGKVPLQSAHLYYNVTEKVRHMMESYFRLEVPLHFSYSHLVCRTAIDEKQEGRSDNSHEVHVDNCILNAEALVCVKEPPAYTFRDYSAILYLNGDFEGGAFYFTELDAKTQTAEVQPQCGRAVGFSSGSENPHGVKAVTKGQRCAIALWFTLDPRHSERERVQADDLVKMLFRTEEVDLLQETSAEQEPTAATSTAGLHAAGKDEL ppib_chick Peptidyl-prolyl cis-trans isomerase B Cyclophilin B S-cyclophilin PPIB Rotamase B protein protein chick Gallus gallus (Chicken) Chicken MKALVAATALGPALLLLLPAASRADERKKGPKVTAKVFFDLRVGEEDAGRVVIGLFGKTVPKTVENFVALATGEKGFGFKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVTIADCGTIEVEKPFAIAKE crtap-lepre1-1 570132 N/A 570134 unspecified role unspecified role bait bait chick-embryo Gallus gallus chick embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. N/A 570135 unspecified role unspecified role prey prey chick-embryo Gallus gallus chick embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association false false false S3 B crtap-lepre1-2 570132 N/A 570134 unspecified role unspecified role prey prey chick-embryo Gallus gallus chick embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. N/A 570135 unspecified role unspecified role bait bait chick-embryo Gallus gallus chick embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association false false false S3 C crtap-lepre1 CRTAP forms a complex with P3H1 a nd CYPB 570133 N/A 570134 unspecified role unspecified role neutral component neutral component region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chick-embryo Gallus gallus chick embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. Stoichiometry: 1.0 N/A 570136 unspecified role unspecified role neutral component neutral component region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 N/A 570135 unspecified role unspecified role neutral component neutral component region 14c radiolabel 14c radiolabel C14 14C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chick-embryo Gallus gallus chick embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. Stoichiometry: 1.0 physical association physical association false false false 5 D, E, S3 A Laser-light-scattering shows that the complex has a molecular mass of 154.6 kDa, which corresponds with the predicted mass of 155 kDa for the trimeric complex.