MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint weltmeier-2006-3 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors. arath-leaf Arabidopsis thaliana leaf leaf leaf 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Weltmeier F., Ehlert A., Mayer CS., Dietrich K., Wang X., Schutze K., Alonso R., Harter K., Vicente-Carbajosa J., Droge-Laser W. Bimolecular Fluorescence Complementation (BiFC) was performed in 6-week-old tobacco plants after Agrobacterium-mediated transient transformation of the YFP tagged expression constructs. wdroege@gwdg.de EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation weltmeier-2006-1 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Weltmeier F., Ehlert A., Mayer CS., Dietrich K., Wang X., Schutze K., Alonso R., Harter K., Vicente-Carbajosa J., Droge-Laser W. Bimolecular Fluorescence Complementation (BiFC) was performed in 6-week-old tobacco plants after Agrobacterium-mediated transient transformation of the YFP tagged expression constructs. wdroege@gwdg.de EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation weltmeier-2006-2 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Weltmeier F., Ehlert A., Mayer CS., Dietrich K., Wang X., Schutze K., Alonso R., Harter K., Vicente-Carbajosa J., Droge-Laser W. Bimolecular Fluorescence Complementation (BiFC) was performed in 6-week-old tobacco plants after Agrobacterium-mediated transient transformation of the YFP tagged expression constructs. wdroege@gwdg.de EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation bzp53_arath bZIP transcription factor 53 BZIP53 T12C14.120 At3g62420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLQMQTSPESDNDPRYATVTDERKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKITEQVDEASKKYIEMESKNNVLRAQASELTDRLRSLNSVLEMVEEISGQALDIPEIPESMQNPWQMPCPMQPIRASADMFDC bzp10_arath Basic leucine zipper 10 BZIP10 BZO2H1 Basic leucine zipper OPAQUE 2 homolog 1 T10P11.9 At4g02640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSIFSIDDFSDPFWETPPIPLNPDSSKPVTADEVSQSQPEWTFEMFLEEISSSAVSSEPLGNNNNAIVGVSSAQSLPSVSGQNDFEDDSRFRDRDSGNLDCAAPMTTKTVIVDSDDYRRVLKNKLETECATVVSLRVGSVKPEDSTSSPETQLQPVQSSPLTQGELGVTSSLPAEVKKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPMLLGRSSGHNNNNRMPITGNNRMDSSSIIPAYQPHSNLNHMSNQNIGIPTILPPRLGNNFAAPPSQTSSPLQRIRNGQNHHVTPSANPYGWNTEPQNDSAWPKKCVD bzp25_arath Basic leucine zipper 25 BZIP25 BZO2H4 Basic leucine zipper OPAQUE 2 homolog 4 T14E10.190 At3g54620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHIVFSVDDLTESFWPVPAPAPSPGSSSTPSPTQNVADGMTRSQSEWAFHRLINELSGSDSSPTTNTIERSPPPVQSLSRLEETVDETEDVVEIQKPQNHRRLPVDDQGKNRNRAPSSDPVDSSAPVVVDPNQYHAILKSKLELACAAVARRVGTVKPEDSSASASNQKQAQGSIVAQTSPGASSVRFSPTTSTQKKPDVPARQTSISSRDDSDDDDLDGDADNGDPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAAAVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSRPNMGIPFSNTPSASSSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAPDSNLYETLPHWNHKH bzp63_arath Basic leucine zipper 63 BZIP63 BZO2H3 Basic leucine zipper OPAQUE 2 homolog 3 T32B20.4 At5g28770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKVFSDEEISGNHHWSVNGMTSLNRSASEWAFNRFIQESSAAADDGESTTACGVSVSSPPNVPVDSEEYRAFLKSKLNLACAAVAMKRGTFIKPQDTSGRSDNGGANESEQASLASSKATPMMSSAITSGSELSGDEEEADGETNMNPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTDVTQTFNDASVENRVLKANIETLRAKVKMAEETVKRLTGFNPMFHNMPQIVSTVSLPSETSNSPDTTSSQVTTPEIISSGNKGKALIGCKMNRTASMRRVESLEHLQKRIRSVGDQ bzip9_arath Basic leucine zipper 9 BZIP9 BZO2H2 Basic leucine zipper OPAQUE 2 homolog 2 F6A4.10 At5g24800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNHTAKDIGMKRSASELALQEYLTTSPLDPCFDLMNRDYTCELRDSLLWSEGLFPAGPFRDAQSSICENLSADSPVSANKPEVRGGVRRTTSGSSHVNSDDEDAETEAGQSEMTNDPNDLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQLIDATQQFRSAGTNNRVLKSDVETLRVKVKLAEDLVARGSLTSSLNQLLQTHLSPPSHSISSLHYTGNTSPAITVHSDQSLFPGMTLSGQNSSPGLGNVSSEAVSCVSDIWP bzp11_arath bZIP transcription factor 11 BZIP11 ATB2 G-box-binding factor 6 GBF6 bZIP transcription factor ATB2 T4L20.170 At4g34590 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSSGTTSSTIQTSSGSEESLMEQRKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKENTEIVTSVSITTQHYLTVEAENSVLRAQLDELNHRLQSLNDIIEFLDSSNNNNNNNMGMCSNPLVGLECDDFFVNQMNMSYIMNQPLMASSDALMY bzp44_arath bZIP transcription factor 44 BZIP44 F1B16.8 At1g75390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNNKTEMGSSTSGNCSSVSTTGLANSGSESDLRQRDLIDERKRKRKQSNRESARRSRMRKQKHLDDLTAQVTHLRKENAQIVAGIAVTTQHYVTIEAENDILRAQVLELNHRLQSLNEIVDFVESSSSGFGMETGQGLFDGGLFDGVMNPMNLGFYNQPIMASASTAGDVFNC bzip2_arath bZIP transcription factor 2 BZIP2 FTM3 G-box-binding factor 5 GBF5 Protein FLORAL TRANSITION AT THE MERISTEM 3 At2g18160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSTYRSSSSSDGGNNNPSDSVVTVDERKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQAENSVLTAQMEELSTRLQSLNEIVDLVQSNGAGFGVDQIDGCGFDDRTVGIDGYYDDMNMMSNVNHWGGSVYTNQPIMANDINMY bzip53-bzip10-4 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP10 protein 495388 N/A 495391 unspecified role unspecified role bait bait n/a 495392 unspecified role unspecified role prey prey physical association physical association false false false Figure 5 bzip53-bzip25-3 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP25 protein 495388 N/A 495391 unspecified role unspecified role bait bait N/A 495393 unspecified role unspecified role prey prey physical association physical association false false false Figure 5 bzip53-bzip63-3 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP63 protein 495388 N/A 495394 unspecified role unspecified role prey prey N/A 495391 unspecified role unspecified role bait bait physical association physical association false false false Figure 5 bzip53-bzip9-3 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP9 protein 495388 N/A 495395 unspecified role unspecified role prey prey N/A 495391 unspecified role unspecified role bait bait physical association physical association false false false Figure 5 bzip53-bzip11-2 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP11 protein 495388 n/a 495396 unspecified role unspecified role prey prey N/A 495391 unspecified role unspecified role bait bait physical association physical association false false false Figure 5 bzip53-bzip44-2 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP44 protein 495388 N/A 495397 unspecified role unspecified role prey prey N/A 495391 unspecified role unspecified role bait bait physical association physical association false false false Figure 5 bzip53-bzip2-1 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP2 protein 495388 N/A 495391 unspecified role unspecified role bait bait N/A 495398 unspecified role unspecified role prey prey physical association physical association false false false Figure 5 bzip53-bzip63-2 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP63 protein 495389 N/A 495391 unspecified role unspecified role bait bait N/A 495394 unspecified role unspecified role prey prey physical association physical association false false false Figure 3A bzip53-bzip9-2 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP9 protein 495389 N/A 495391 unspecified role unspecified role bait bait Q9LZP8:p.Leu51Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q9LZP8:p.Ala72Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 495395 unspecified role unspecified role prey prey physical association physical association false false false Figure 3A bzip53-bzip25-2 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP25 protein 495389 N/A 495391 unspecified role unspecified role bait bait N/A 495393 unspecified role unspecified role prey prey physical association physical association false false false Figure 3A bzip53-bzip10-2 Directed yeast-2-hybrid reveals interaction between atbZIP53 protein and the atbZIP10 protein 495389 N/A 495391 unspecified role unspecified role bait bait Q9LZP8:p.Leu51Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q9LZP8:p.Ala72Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 495392 unspecified role unspecified role prey prey physical association physical association false false false Figure 3A bzip53-bzip10-3 BiFC analysis reveals interaction between atbZIP53 protein and the atbZIP10 protein 495390 n/a 495392 unspecified role unspecified role neutral component neutral component region N terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 495391 unspecified role unspecified role neutral component neutral component region C terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9LZP8:p.Leu51Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q9LZP8:p.Ala72Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Figure 4A