MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint katunuma-2006-1 A novel apoptosis cascade mediated by lysosomal lactoferrin and its participation in hepatocyte apoptosis induced by D-galactosamine. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Katunuma N., Le QT., Murata E., Matsui A., Majima E., Ishimaru N., Hayashi Y., Ohashi A. katunuma@tokushima.bunri-u.ac.jp FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation casp3_rat Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 LICE IRP Casp3 Cpp32 protein protein rat Rattus norvegicus (Rat) Rat MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH casp3-casp3 491677 casp3_rat 491678 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role self self purified purified Stoichiometry: 1.0 casp3_rat 491678 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role self self purified purified Stoichiometry: 1.0 cleavage cleavage reaction cleavage false false false F3 kd 100 micromolar lactoferrin enhances the autocatalytic activation homomint mint