IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zohn-2006-3 p38 and a p38-interacting protein are critical for downregulation of E-cadherin during mouse gastrulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zohn IE., Li Y., Skolnik EY., Anderson KV., Han J., Niswander L. lee.niswander@uchsc.edu Cell (0092-8674) 2006 Only protein-protein interactions 4 imex curation zohn-2006-1 p38 and a p38-interacting protein are critical for downregulation of E-cadherin during mouse gastrulation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zohn IE., Li Y., Skolnik EY., Anderson KV., Han J., Niswander L. lee.niswander@uchsc.edu Cell (0092-8674) 2006 Only protein-protein interactions 4 imex curation zohn-2006-2 p38 and a p38-interacting protein are critical for downregulation of E-cadherin during mouse gastrulation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zohn IE., Li Y., Skolnik EY., Anderson KV., Han J., Niswander L. lee.niswander@uchsc.edu Cell (0092-8674) 2006 Only protein-protein interactions 4 imex curation mk14_human Mitogen-activated protein kinase 14 Mitogen-activated protein kinase p38 alpha Cytokine suppressive anti-inflammatory drug-binding protein MAX-interacting protein 2 MAP kinase MXI2 SAPK2A MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 Stress-activated protein kinase 2a protein protein human Homo sapiens Human MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES sp20h_human Transcription factor SPT20 homolog SUPT20H C13orf19 FAM48A p38-interacting protein FP757 protein protein human Homo sapiens Human MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRNVNLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLDPSIAVTCTANRLLYNKQKMNTRPMKRCFKRYSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCNLAIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGDPLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCPVKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNYFTPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMANSAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF sp20h_mouse Transcription factor SPT20 homolog Supt20h D3Ertd300e Fam48a p38-interacting protein Supt20 protein protein mouse Mus musculus Mouse MQQAVEQALDCAEYIVESAQQRPPKRKYLSSGRKSIFQKLYDLYVEECEKEPEVKKLRRNVNLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLVCDVHSITSDNHKWTQEDKLLLESQLILATAEPLCLDPSVAVACTANRLLYNRQKMNTRPMKRCWKRYSRSSLNRQQDLSHGPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCNLAVPSEVDVEKYAKVEESIKSDDSQPTMWPAHDVKDDYVFECEGGNQYQKTKLTILQSLGDPLYYGKIQPWKADEENDSQMSPSHSSADDHSNWFVIGSKTDAERVVNQYQELVQNEAKCPVKMSHSSSGSAALSPGEEAEQAETSSIQSSVLGKGVKHRPPPIKLPSGSGNSSSGNYFTAQQASSFLKSPTPPPSCKPSLSRKSSVDLSQVSMLSPAALSPASSSQRHES fam48a-mapk14-2 491768 N/A 491771 unspecified role unspecified role bait bait N/A 491772 unspecified role unspecified role prey prey c terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2C-G Interaction confirmed by Beta gal assay. fam48a-mapk14-3 491768 N/A 491771 unspecified role unspecified role bait bait N/A 491773 unspecified role unspecified role prey prey physical association physical association false false false 2G fam48a-mapk14 491769 N/A 491771 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 491772 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2A fam48a-mapk14-1 491770 N/A 491771 unspecified role unspecified role prey prey N/A 491772 unspecified role unspecified role bait bait physical association physical association false false false 2B