MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tsuda-2006-2 POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tsuda M., Seong KH., Aigaki T. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation tsuda-2006-3 POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Tsuda M., Seong KH., Aigaki T. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation tsuda-2006-1 POSH, a scaffold protein for JNK signaling, binds to ALG-2 and ALIX in Drosophila. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tsuda M., Seong KH., Aigaki T. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation q9nhp2_drome RING-type E3 ubiquitin transferase POSH CG4909 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDEHTLNDLLECSVCLERLDTTSKVLPCQHTFCRKCLQDIVASQHKLRCPECRILVSCKIDELPPNVLLMRILEGMKQNAAAGKGEEKGEETETQPERAKPQPPAESVAPPDNQLLQLQSHQQSHQPARHKQRRFLLPHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLPMPQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFVELNAAAKKLLDSGLHTHPLCHPPKQQGQRALPPVPVIDPTVVTESSSGSSNSTPGSSNSSSTSSSNNCSPNHQISLPNTPQHVVASGSASVRFRDKGAKEKRHSLNALLGGGAPLSLLQTNRHSAEILSLPHELSRLEVSSSTALKPTSAPQTSRVLKTTVQQQMQPNLPWGYLALFPYKPRQTDELELKKGCVYIVTERCVDGWFKGKNWLDITGVFPGNYLTPLRARDQQQLMHQWKYVPQNADAQMAQVQQHPVAPDVRLNNMLSMQPPDLPPRQQQATATTTSCSVWSKPVEALFSRKSEPKPDTATASTTSSSSSGAVGLMRRLTHMKTRSKSPGASLQQVPKEAISTNVEFTTNPSAKLHPVHVRSGSCPSQLQHSQPLNETPAAKTAAQQQQFLPKQLPSASTNSVSYGSQRVKGSKERPHLICARQSLDAATFRSMYNNAASPPPPTTSVAPAVYAGGQQQVIPGGGAQSQLHANMIIAPSHRKSHSLDASHVLSPSSNMITEAAIKASATTKSPYCTRESRFRCIVPYPPNSDIELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVEPDC mint q9vb05_drome ALiX AIP1 ALIX Aip1 Alix DAIP1 Dmel\CG12876 Snf7 alix Dmel_CG12876 CG12876 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKFLGVPLKKPSEVDVIKPLNNLIQSTYNGASEEEKGKYGEAVNEFSKQRNTAIWKFFEKYEASLEIVYAYYDQICALETKISVSELQIPFKWKDAFDKGSIFGGKISLTHTSLLYEKVCVLFNIAALQSNIAANQSLDSDDGLKLTIKLLQQSAGIFQYLKGATPAAVPSEPTPDLSQDTLTVLQALMVAQAQEVFILKAIKDNLKDQIIAKLCCQAEESYADVLRAMQKESVRSLWEKEWIPTIAGKQAGFHALTQLYQSLVCRAAKKIGEEIARLRNAIDLFKAAQTRSGNETYLDEYFSRAKRNLTESTKDNEFIYNEIIPELSTLTSPGKAQLAKPLPIAVPLAENFKDIFSSLVPVELHRALTASDMRRNEIVNVEIMKLREATQTLNAVLASLNLPAAVETADGNSGLPPSLKEKANEVRQKGGIENVQTMLKDLPELLNRNREILDETERLLDEERDSDNQLRAQFKDRWTRISSDKLTEMFRTNAKKYREVITNAIEADKVVRQKFEANQKGIQLLSLPPDQIQQSLPSASGSVDPNCSSVQRLKKLMDDVETIKAEREAIESELKGATFNMKDEFLIALQKDGAIDEPALSLARIGQVLNPLQQQVRESVERQQSLVSEIQSAHGAFVSETGSCGSSRDTLYQELATAFDSYIELSGNLQEGTKFYNDLTQLLVVFQNKISDFVFARKTEKEELLKDLTTESSRQACPATPALPSHYASTSGSGSDIPPGSAPSVPPAASTANIPYPAQVQGMPIPYGAQPGVPYPAYVPAPMPQSFNPYATLPYPGNYQYQGFPQGPPPGHYGTYPGSYANQQGGYPNQKPPGW q9vbm1_drome MLC1 BcDNA:AT16150 CG5024-RA Dmel\CG5024 gene1 CG5024 Dmel_CG5024 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDDFDFSSPPPEVRTVHTHTLNDEQLKDCEAAFALFDDDNAKVIPIKLLRDCLRAVAHNPPENEIQDYITEIDTDGSGELYLSDFLYIMSKRYENLTVEDEVILAFKVFDKDGSGFIHENEFRQIMTEYGDEMEEDEIEEMIRDADANTELKIDYVRFVTMMMET q7k2l7_drome Dmel\CG17765 CG17765 Dmel_CG17765 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSYGQGYNPYAQPGGGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAIGCSY alix-posh 490667 q9nhp2_drome 490670 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 q9vb05_drome 490671 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1A homomint mint alix-cg5024_ra 490667 q9vb05_drome 490671 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q9vbm1_drome 490672 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F1C GST ALIX protein was also able to bind to ALG-2, but only in the presence of calcium. mint posh-alix 490667 q9nhp2_drome 490670 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q9vb05_drome 490671 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false proline rich Stoichiometry: 1.0 physical association physical association false false false F1B homomint mint q7k2l7-alix 490667 q9v5m1_drome 490673 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q9vb05_drome 490671 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false proline rich Stoichiometry: 1.0 physical association physical association false false false F1B mint posh-alix-1 490668 q9nhp2_drome 490670 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 q9vb05_drome 490671 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association false false false F1D homomint mint posh-q7k2l7-1 490668 q9nhp2_drome 490670 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 q9v5m1_drome 490673 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association false false false F1D mint posh-q7k2l7 490669 q9nhp2_drome 490670 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q9v5m1_drome 490673 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false NFA mint