MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ott-2006-1 Mba1, a membrane-associated ribosome receptor in mitochondria. yeast Saccharomyces cerevisiae Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Ott M., Prestele M., Bauerschmitt H., Funes S., Bonnefoy N., Herrmann JM. EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation ott-2006-2 Mba1, a membrane-associated ribosome receptor in mitochondria. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ott M., Prestele M., Bauerschmitt H., Funes S., Bonnefoy N., Herrmann JM. EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation mba1_yeast Inner membrane mitoribosome receptor MBA1, mitochondrial MBA1 Multi-copy bypass of AFG3 protein YBR1307 YBR185C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVLRSTCLFFPPRSLLISFNKRRLFSTSRLILNKESETTKKKDKSKQQDFNPRHLGVAAEIFIPSAYKNLPNVFAHPLIVANALIRRLYTFGLNSVQVALFRFQSGIKPSFLLWKNKAIETYINVNTSFAHKNLSDIKGLVSLWVQEALEARSRQLPGNATLDWQLIKFNAVPKLVSVQPIMIPGMPLEHLQLVYKFDTKQRLIKVNQQTKKTETLDRDVVDYIAFLCDATTNDMILMGSLFESKPNDKLPKSYEDDAKVAIHRMKVNGDIYRLPPS oxa1_yeast Mitochondrial inner membrane protein OXA1 OXA1 PET1402 Oxidase assembly protein 1 Cytochrome oxidase biogenesis protein OXA1 YER154W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFKLTSRLVTSRFAASSRLATARTIVLPRPHPSWISFQAKRFNSTGPNANDVSEIQTQLPSIDELTSSAPSLSASTSDLIANTTQTVGELSSHIGYLNSIGLAQTWYWPSDIIQHVLEAVHVYSGLPWWGTIAATTILIRCLMFPLYVKSSDTVARNSHIKPELDALNNKLMSTTDLQQGQLVAMQRKKLLSSHGIKNRWLAAPMLQIPIALGFFNALRHMANYPVDGFANQGVAWFTDLTQADPYLGLQVITAAVFISFTRLGGETGAQQFSSPMKRLFTILPIISIPATMNLSSAVVLYFAFNGAFSVLQTMILRNKWVRSKLKITEVAKPRTPIAGASPTENMGIFQSLKHNIQKARDQAERRQLMQDNEKKLQESFKEKRQNSKIKIVHKSNFINNKK rm20_yeast 54S ribosomal protein L20, mitochondrial MRPL20 YKR085C YKR405 YmL20 Mitochondrial large ribosomal subunit protein mL58 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIGRGVCCRSFHTAGSAWKQFGFPKTQVTTIYNKTKSASNYKGYLKHRDAPGMYYQPSESIATGSVNSETIPRSFMAASDPRRGLDMPVQSTKAKQCPNVLVGKSTVNGKTYHLGPQEIDEIRKLRLDNPQKYTRKFLAAKYGISPLFVSMVSKPSEQHVQIMESRLQEIQSRWKEKRRIAREDRKRRKLLWYQA 3165663C8C19EC60 rm36_yeast 54S ribosomal protein L36, mitochondrial MRPL36 YBR122C YBR0918 YmL36 Mitochondrial large ribosomal subunit protein bL31m protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRRSQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSSETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK 7A8DF86EE899B848 mba1-oxa1 370539 mba1_yeast 370541 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 oxa1_yeast 370542 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F1 mint mrpl20-oxa1 370539 oxa1_yeast 370542 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 rm20_yeast 370543 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F1 mint mba1-mrpl20 370539 rm20_yeast 370543 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 mba1_yeast 370541 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F1 mint mba1-oxa1-1 370540 mba1_yeast 370541 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 oxa1_yeast 370542 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level in vitro translated in vitro translated protein in vitro translated undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3A mint mba1-mrpl36 370540 rm36_yeast 370544 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 mba1_yeast 370541 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F3A mint