MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint itzen-2006-1 Nucleotide exchange via local protein unfolding--structure of Rab8 in complex with MSS4. in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Itzen A., Pylypenko O., Goody RS., Alexandrov K., Rak A. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation itzen-2006-2 Nucleotide exchange via local protein unfolding--structure of Rab8 in complex with MSS4. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Itzen A., Pylypenko O., Goody RS., Alexandrov K., Rak A. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL mss4_human Guanine nucleotide exchange factor MSS4 Rab-interacting factor RABIF MSS4 RASGRF3 protein protein human Homo sapiens Human MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE rab8a-rabif 501142 rab8a_human 501144 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role fluorescence donor fluorescence donor purified purified Stoichiometry: 1.0 mss4_human 501145 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified Stoichiometry: 1.0 physical association physical association false false false F2 F1 kd 0,7 nanomolar homomint mint rab8a-rabif-1 501143 mss4_human 501145 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 rab8a_human 501144 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false F3 T1 homomint mint