IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ singh-2006-4 Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation singh-2006-1 Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation singh-2006-2 Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation singh-2006-3 Assembly, activation, and trafficking of the Fet3p.Ftr1p high affinity iron permease complex in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Singh A., Severance S., Kaur N., Wiltsie W., Kosman DJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Interaction is detected by quantification of the Beta-galactosidase activity. Beta-galactosidase activity ranging from 1 to 8. fig 3 camkos@buffalo.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation ftr1_yeast Plasma membrane iron permease FTR1 YER145C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQVWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMISMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLLPFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLYYGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEGGDGNGSYNIRKAVYHVNCCNPELDNGWDIFNALLGWQNTGYLSSMLCYNIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTEEQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLHVKADSL fet3_yeast Iron transport multicopper oxidase FET3 YM9796.11 YMR058W FET3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTNALLSIAVLLFSMLSLAQAETHTFNWTTGWDYRNVDGLKSRPVITCNGQFPWPDITVNKGDRVQIYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLTQCPIAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDDSFPYDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNLTWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDMLYITVAQRYTVLVHTKNDTDKNFAIMQKFDDTMLDVIPSDLQLNATSYMVYNKTAALPTQNYVDSIDNFLDDFYLQPYEKEAIYGEPDHVITVDVVMDNLKNGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDEIVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSFDPDNHPAFPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLVEDPFGIQDAHSQQLSENHLEVCQSCSVATEGNAAANTLDLTDLTGENVQHAFIPTGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLHVDPEVLLNEVDENEERQVNEDRHSTEKHQFLTKAKRFF 71CB4352B87746E6 ctr1_yeast Copper transport protein CTR1 CTR1 P9642.3 YPR124W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGMNMGSSMNMDAMSSASKTVASSMASMSMDAMSSASKTILSSMSSMSMEAMSSASKTLASTMSSMASMSMGSSSMSGMSMSMSSTPTSSASAQTTSDSSMSGMSGMSSSDNSSSSGMDMDMSMGMNYYLTPTYKNYPVLFHHLHANNSGKAFGIFLLFVVAAFVYKLLLFVSWCLEVHWFKKWDKQNKYSTLPSANSKDEGKHYDTENNFEIQGLPKLPNLLSDIFVPSLMDLFHDIIRAFLVFTSTMIIYMLMLATMSFVLTYVFAVITGLALSEVFFNRCKIAMLKRWDIQREIQKAKSCPGFGNCQCGRHPEPSPDPIAVADTTSGSDQSTRLEKNNESKVAISENNQKKTPTQEEGCNCATDSGKNQANIERDILENSKLQEQSGNMDQNLLPAEKFTHN 569C9CB19C1117E8 fth1_yeast Iron transporter FTH1 YBR1446 YBR207W FTH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAFEDYFSFQIFFIFLRESLEIVVIVSILLTIVKQGLSVEDDSPFEGSSSSAGLPSPNTNTNADSTTAFLQAGPSDGNAIGTSATAANNKSRPLNVEEEEEIYEYSNELRDQDRESDEHTADNVKLYQKLKIQILAGGAFGLLLCMLIGGAFVSIFYHIGTDLWTLSEHYYEGVLSLVASVIISVMGLFFLRMGKLREKFRVKLASIIYSKDNNLLGNKTQKGVKFSEKYSFFILPFITTLREGLEAVVFIGGIGIDQPLSSIPLSMVLATAISTVFGIFFFRYSSSLSLKICLVVATCFLYLIAAGLFSKGVWQLELQDYVNKCNGQDMSEVGNGPGSYDISRSVWHVNCCNGEKDGGWMIFTAIFGWTNSATVGSVISYNAYWLVLICALKLLMIEEKYGYIPYLPISWQKKRIMKRLSIAKASLDLKHHTSELNSSTSEPDSQRRSKDSSVPLIIDSSGSAN 7B4E620ABC39A053 fet5_yeast Iron transport multicopper oxidase FET5 YFL041W FET5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLFYSFVWSVLAASVALAKTHKLNYTASWVTANPDGLHEKRMIGFNGEWPLPDIHVEKGDRVELYLTNGFQDNTATSLHFHGLFQNTSLGNQLQMDGPSMVTQCPIVPGQTYLYNFTVPEQVGTFWYHAHMGAQYGDGMRGAFIIHDPEEPFEYDHERVITLSDHYHENYKTVTKEFLSRYNPTGAEPIPQNILFNNTMNVTLDFTPGETYLFRFLNVGLFVSQYIILEDHEMSIVEVDGVYVKPNFTDSIYLSAGQRMSVLIKAKDKMPTRNYAMMQIMDETMLDVVPPELQLNQTIQMRYGHSLPEARALNIEDCDLDRATNDFYLEPLIERDLLAHYDHQIVMDVRMVNLGDGVKYAFFNNITYVTPKVPTLTTLLTSGKLASDPRIYGDNINAQLLKHNDIIEVVLNNYDSGRHPFHLHGHNFQIVQKSPGFHVDEAYDESEQDEMTVPYNESAPLQPFPERPMVRDTVVLEPSGHVVLRFRADNPGVWYFHCHVDWHLQQGLASVFIEAPVLLQEREKLNENYLDICKAADIPVVGNAAGHSNDWFDLKGLPRQPEPLPKGFTTEGYLALIISTIIGVWGLYSIAQYGIGEVIPNDEKVYHTLREILAENEIEVSRG fet3-ftr1-3 In vivo FRET between Fet3p and Ftr1p : FRET curves analysis 363938 N/A 363942 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 363943 unspecified role unspecified role fluorescence donor fluorescence donor region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 363952 363949 proximity proximity close-contact colocalization neighbourhood interaction false false false fet3-ftr1-4 In vivo FRET between Fet3p and Ftr1p 363938 N/A 363942 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 363943 unspecified role unspecified role fluorescence donor fluorescence donor region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 363960 363957 proximity proximity close-contact colocalization neighbourhood interaction false false false ctr1-ctr1-1 In vitro FRET shows interaction between Ctr1p proteins 363938 N/A 363944 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 363944 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false fet3-ftr1-1 Y2H: bait = Fet3p, prey = Ftr1p 363939 N/A 363942 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false N/A 363943 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Two Fet3p Binding regions in Ftr1p were described in the article : loop 6 (231-291) and another region (317-320). The beta-gal activity was measured as 8. fet5-fth1-1 Y2H: bait = Fet5p, prey = Fth1p 363939 N/A 363945 unspecified role unspecified role prey prey N/A 363946 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The beta-gal activity was measured as 4 The ER signal of Fet5p was removed for Y2H. fet3-ftr1-2 Y2H: bait = Fet3p, prey = Ftr1p 363940 N/A 363943 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 363942 unspecified role unspecified role prey prey loop 6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Two Fet3p Binding regions in Ftr1p were described in the article : loop 6 (231-291) and another region (317-320). The ER signal of Fet3p was removed for Y2H. fet5-fth1-2 Y2H: bait = Fet5p, prey = Fth1p 363940 N/A 363946 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 363945 unspecified role unspecified role prey prey physical association physical association false false false The ER signal of Fet5p was removed for Y2H. fet3-ftr1-5 Colocalization of Fet3p and Ftr1p at the plasma membrane 363941 N/A 363942 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 363943 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal cfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fet3p�Ftr1p interaction motifs (317-320 for ftr1 and 581-584 for fet3) are required for protein trafficking to the yeast plasma membrane.