IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cole-2006-1 Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cole M., Nolte C., Werr W. Figure 2 A werr@uni-koeln.de Meristem enriched cDNA library (Lumbrineris erecta 4-5mm in size) containing inflorescence and multiple floral meristems. Nucleic Acids Res. (0305-1048) 2006 Only protein-protein interactions imex curation cole-2006-2 Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cole M., Nolte C., Werr W. Figure 2 A werr@uni-koeln.de Meristem enriched cDNA library (Lumbrineris erecta 4-5mm in size) containing inflorescence and multiple floral meristems. Nucleic Acids Res. (0305-1048) 2006 Only protein-protein interactions imex curation cole-2006-3 Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana. allpo Allium porrum (Leek) bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Cole M., Nolte C., Werr W. Bombardment of leek epidermal cells by tungsten particles coated with chimeric gene constructs. Figure 2 A werr@uni-koeln.de Meristem enriched cDNA library (Lumbrineris erecta 4-5mm in size) containing inflorescence and multiple floral meristems. Nucleic Acids Res. (0305-1048) 2006 Only protein-protein interactions imex curation ath1_arath Homeobox protein ATH1 ATH1 At4g32980 F26P21.100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNNNNNNTFSSLDNVMTNQNPLLMDFIPSREDSTSFSTMLPWNTIRSDPLQMGGFDIFNSMLTNKYLSSSPRSIDVQDNRNVEFMAPPPHPPPLHPLDHLRHYDDSSNNMWGFEANSEFQAFSGVVGPSEPMMSTFGEEDFPFLISNKRNNELSLSLASDVSDECSEISLCAATRLASEQASCSSKDISNNVVTQGFSQLIFGSKYLHSVQEILSHFAAYSLDYSSRGTESGAASSAFTSRFENITEFLDGDSNNSEAGFGSTFQRRALEAKKTHLLDLLQMVDDRYSHCVDEIHTVISAFHAATELDPQLHTRFALQTVSFLYKNLRERICKKIISMGSVLERGKDKTQETSMFHQHCLLQQLKRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVRLWKPMIEEMYAEMNKRKLNNSHIQPNGPTLRMPKSVMMSQAMHK stm_arath Homeobox protein SHOOT MERISTEMLESS At1g62360 F2401.9 STM protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGSNSTSCPMAFAGDNSDGPMCPMMMMMPPIMTSHQHHGHDHQHQQQEHDGYAYQSHHQQSSSLFLQSLAPPQGTKNKVASSSSPSSCAPAYSLMEIHHNEIVAGGINPCSSSSSSASVKAKIMAHPHYHRLLAAYVNCQKVGAPPEVVARLEEACSSAAAAAASMGPTGCLGEDPGLDQFMEAYCEMLVKYEQELSKPFKEAMVFLQRVECQFKSLSLSSPSSFSGYGETAIDRNNNGSSEEEVDMNNEFVDPQAEDRELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFVVMDATHPHHYFMDNVLGNPFPMDHISSTML blh3_arath BEL1-like homeodomain protein 3 BLH3 F1B16.6 At1g75410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVYYPNSVGMQSLYQESIYLNEQQQQQQQASSSSAASFSEIVSGDVRNNEMVFIPPTSDVAVNGNVTVSSNDLSFHGGGLSLSLGNQIQSAVSVSPFQYHYQNLSNQLSYNNLNPSTMSDENGKSLSVHQHHSDQILPSSVYNNNGNNGVGFYNNYRYETSGFVSSVLRSRYLKPTQQLLDEVVSVRKDLKLGNKKMKNDKGQDFHNGSSDNITEDDKSQSQELSPSERQELQSKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQIQVIRGKLGERETSDEQGERIPRLRYLDQRLRQQRALHQQLGMVRPAWRPQRGLPENSVSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANWFINARVRLWKPMIEEMYKEEFGESAELLSNSNQDTKKMQETSQLKHEDSSSSQQQNQGNNNNNIPYTSDAEQNLVFADPKPDRATTGDYDSLMNYHGFGIDDYNRYVGLGNQQDGRYSNPHQLHDFVV blh9_arath BEL1-like homeodomain protein 9 BLH9 BLR LSN PNY RPL VAN Protein BELLRINGER Protein LARSON Protein PENNYWISE Protein REPLUMLESS Protein VAAMANA T7H20_80 At5g02030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADAYEPYHVLQQSRRDKLRIPSLDSHFHFHPPPPPSSGGGGGVFPLADSDFLAAGGFHSNNNNNHISNPSYSNFMGFLGGPSSSSSTAVAVAGDHSFNAGLSSGDVLVFKPEPLSLSLSSHPRLAYDLVVPGVVNSGFCRSAGEANAAAVTIASRSSGPLGPFTGYASILKGSRFLKPAQMLLDEFCNVGRGIYTDKVIDDDDSSLLFDPTVENLCGVSDGGGGDNGKKKSKLISMLDEVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYANLALKALSKHFKCLKNAITDQLQFSHNNKIQQQQQCGHPMNSENKTDSLRFGGSDSSRGLCSAGQRHGFPDHHAPVWRPHRGLPERAVTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETRQSQRSSSSSWRDERTSTTVFPDNSNNNPSSSSAQQRPNNSSPPRRARNDDVHGTNNNNSYVNSGSGGGSAVGFSYGIGSSNVPVMNSSTNGGVSLTLGLHHQIGLPEPFPMTTAQRFGLDGGSGDGGGGYEGQNRQFGRDFIGGSNHQFLHDFVG stm-ath1 Yeast 2 hybrid analysis reveals interaction between the STM protein and ATH1 protein 361756 N/A 361759 unspecified role unspecified role prey prey N/A 361760 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false stm-blh3 Yeast 2 hybrid analysis reveals interaction between the STM protein and BLH3 protein 361756 N/A 361761 unspecified role unspecified role prey prey N/A 361760 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false stm-blh9 Yeast 2 hybrid analysis reveals interaction between the STM protein and BLH9 protein 361756 N/A 361762 unspecified role unspecified role prey prey N/A 361760 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false stm-ath1-1 Coimmunoprecipitation analysis reveals interaction between the STM protein and ATH1 protein 361757 N/A 361760 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361759 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false stm-blh3-1 Coimmunoprecipitation analysis reveals interaction between the STM protein and BLH3 protein 361757 N/A 361761 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361760 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false stm-blh9-1 Coimmunoprecipitation analysis reveals interaction between the STM protein and BLH9 protein 361757 N/A 361760 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361762 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false stm-ath1-2 Colocalisation reveals interaction between the STM protein and ATH1 protein 361758 N/A 361759 unspecified role unspecified role neutral component neutral component region C terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361760 unspecified role unspecified role neutral component neutral component region N terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The proteins colocalised to the nucleus. Interaction of STM with ATH1 resulted in movement of STM into the nucleus. stm-blh3-2 Colocalisation reveals interaction between the STM protein and BLH3 protein 361758 N/A 361760 unspecified role unspecified role neutral component neutral component region C terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361761 unspecified role unspecified role neutral component neutral component region N terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The proteins colocalised to the nucleus. Interaction of STM with BLH3 resulted in movement of STM into the nucleus. stm-blh9-2 Colocalisation reveals interaction between the STM protein and BLH9 protein 361758 N/A 361760 unspecified role unspecified role neutral component neutral component region C terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361762 unspecified role unspecified role neutral component neutral component region N terminal yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The proteins colocalised to the nucleus. Interaction of STM with BLH9 resulted in movement of STM into the nucleus.