IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mahajan-2006-2 Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum). in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Mahajan S., Sopory SK., Tuteja N. Directed yeast two hybrid assay. Figure 6 (E) to (K). narendra@icgeb.res.in FEBS J. (1742-464X) 2006 mahajan-2006-1 Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mahajan S., Sopory SK., Tuteja N. Directed yeast two hybrid assay. Figure 6 (E) to (K). narendra@icgeb.res.in FEBS J. (1742-464X) 2006 mahajan-2006-3 Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum). tobac-by_2 Tobacco cell line by_2 Tobacco cell line An undifferentiated cell line derived from tobacco callus tissue. An undifferentiated cell line derived from tobacco callus tissue. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Mahajan S., Sopory SK., Tuteja N. Directed yeast two hybrid assay. Figure 6 (E) to (K). narendra@icgeb.res.in FEBS J. (1742-464X) 2006 q8l7f6_pea CnB protein protein pea Pisum sativum (Garden pea) Garden pea MLQCLEGFKSLLASVLRCCDIDINQPRGLEDPELLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT q84xc0_pea Non-specific serine/threonine protein kinase protein protein pea Pisum sativum (Garden pea) Garden pea MAVVAAPKKNNSFNKKDNPNLLLGRFELGKLLGHGTFAKVHLAKNIKTGEAVAIKIISKDKILKSGLVSHIKREISILRRVRHPNIVQLFEVMATKTKIYFVMEYVRGGELFNKVAKGRLKEEVARKYFQQLICAVEFCHARGVFHRDIKPENLLLDENGNLKVSDFGLSAVSDEIKQDGLFHTFCGTPAYVAPEVLSRKGYDGGKVDIWSCGVVLFVLMAGYLPFHDPNNVMVMYKKIYKGDFRCPRWFSPELVNLLTRLLDTKPQTRISIPEIMENRWFKIGFKRIKFYVEDDVVCNLDSLGLDGNNGNDGNDDKKVLNIDEHRDEALESVSESEWDSEVVNRRKNRQLGSLPRPASLNAFDIISFSQGFDLSGLFEEKGDEARFVSGASVSKIMTKLEEVAQLVSFKVRKKDCRVSFEGSREGVKGPLSIAAEVFELTPSLVVVEVKKKGGDKVEYDRFLNTELKSALHSLTMEESAGSSCQNTPDETLQQRAFSDSAIDKHSDSIESLNLDT cnb-cipk-1 Far western analysis reveals interaction between the CnB protein and CIPK protein 364414 N/A 364417 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 364418 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false cipk-cnb Far western analysis reveals interaction between the CIPK protein and CnB protein 364414 N/A 364418 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 364417 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false cnb-cipk Directed Yeast 2 hybrid analysis reveals interaction between the CnB protein and CIPK protein 364415 N/A 364417 unspecified role unspecified role bait bait N/A 364418 unspecified role unspecified role prey prey physical association physical association false false false cnb-cipk-2 Colocalisation analysis reveals interaction between the CnB protein and CIPK protein 364416 N/A 364417 unspecified role unspecified role neutral component neutral component N/A 364418 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Interacting proteins colocalised to the cytoplasm.