MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint shoji-2006-1 Mammalian Emi2 mediates cytostatic arrest and transduces the signal for meiotic exit via Cdc20. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Shoji S., Yoshida N., Amanai M., Ohgishi M., Fukui T., Fujimoto S., Nakano Y., Kajikawa E., Perry AC. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation shoji-2006-2 Mammalian Emi2 mediates cytostatic arrest and transduces the signal for meiotic exit via Cdc20. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Shoji S., Yoshida N., Amanai M., Ohgishi M., Fukui T., Fujimoto S., Nakano Y., Kajikawa E., Perry AC. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation fbx43_mouse F-box only protein 43 Emi2 Fbxo43 Endogenous meiotic inhibitor 2 protein protein mouse Mus musculus Mouse MDSSAVTVKGLSLIDFCSTSSFKYRGHHELSESCSLNKKEEEPMLTCEHPETPSLGSPNSAVSPSQIMKSVSLRKEKDKSPELCETPKLRRKKCTLRRRLDFSFPLLKGDSDSQSRSLESNISQGVSLEKHLPGSTSGFPKEDNFSPLVTSTIKTEDVVSNSQNSRLHFSQHKTSTIEDSKDNCGLFEVECLSPIEGNDFKDSITHFSDSSLSVSDENTCPELLGSCGSQTTYGADVTTSVTPVSSLIAKIKFNGNQTLDSSGEVRDSLFTPEDSGFCSLSWDKSEDFLSDQEGSFQELLQKHRVTPKVGDQVKKPKHFGRLRRLSTLQEQGQSEDEMQTVHPNSDSGVLESLQGSEEKRGNLALSFKDLSNTPALQLVQELFMKSKRKRSQQEDDQEFFEDRDEGKIARLQRVLAGLIGKKMGIEQLDILTELQYRNLKHILAMVLESLTSESLYSAWNVSRNWREIVAQDKKANRRRKLYIIQLRASAQGAAVLRVQDAATRLCLLSRLALRSVQAQAQAPSGEQVPTLSPWGDVLTPVASSSLTHLRSKQEQYVKVARTLFTDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRGSAKARGSKDVLPGSAQSKRNLKRL mint Required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. Probably acts by inhibiting the anaphase-promoting complex/cyclosome (APC/C) ubiquitin ligase. Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation cdc20_mouse Cell division cycle protein 20 homolog p55CDC Cdc20 protein protein mouse Mus musculus Mouse MAQFVFESDLHSLLQLDAPIPNAPVARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRFIPQRSASQMEVASFLLSKENQPEDRGTPTKKEHQKAWSLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDYISSVAWIKEGNYLAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWAPLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFEMDPALRREREKASVAKSSLIHQGIR fbxo43-cdc20 499935 fbx43_mouse 499937 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated multiple tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc20_mouse 499938 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association false false false F5A homomint mint cdc20-fbxo43 499936 fbx43_mouse 499937 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated multiple tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc20_mouse 499938 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association false false false F5A homomint mint