MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint karaulan-2006-1 A role for fibronectin-leucine-rich transmembrane cell-surface proteins in homotypic cell adhesion. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Karaulanov EE., Böttcher RT., Niehrs C. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation karaulanov-2006-1 A role for fibronectin-leucine-rich transmembrane cell-surface proteins in homotypic cell adhesion. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Karaulanov EE., Böttcher RT., Niehrs C. EMBO Rep. (1469-221X) 2006 2009-01-08 Only protein-protein interactions imex curation flrt3_xenla Leucine-rich repeat transmembrane protein FLRT3 flrt3 Fibronectin-like domain-containing leucine-rich transmembrane protein 3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSTETWNLFVAWAQFLLLLRMLPQCDSAKPCPSVCRCDAGFIYCNDRDLTSIPSGIPDDATTLYLQNNQINNAGIPSDLKGLDKVERIYLYRNSLDEFPINLPKNVKELHLQENNIRTITYDALLQIPFIEELHLDDNSVSAVSIEDGAFRDNIFLRLLFLSRNHLSTIPWGLPKTIEELRLDDNRISTISEISLQDLTNLKRLVLDGNLLNNNGLGERVFMNLINLTELSLVRNSLTSPPANLPGTSLRKLYLQENHMNYVPPNSFADLTQLYRLDMSNNNLTALPQGIFDDLDNLTQLFLRNNPWYCGCKMKWVRDWLQSLPSKVNVRGLMCQAPERVRGMTIKDLNKELFDCKDRIGSNTIHVTTTMLNSLLPAQGQWPVPVTKQPEIRPPDINKIFRTTPIPVKKIITIQVKSITTETIYISWKVALPMTALRLSWQLGHSPVFGSITETIVTGDRAEYLLTALEPESPYRICMVPMETGNIYLSDETPVCIETETAPLKMYNPTTTLNREQEKEPYKNSSLPLAAIIGGAVALVAITLLALVCWYVHRNGSLFSRNCAYNKGRRRKDDYAEAGTKKDNSILEIRETSFPMIPINSDPLSKEEFIIHTIFPPNGVSLYKNSHSESSSNRSYRDSGIPDSDHSHS mint flrt1_human Leucine-rich repeat transmembrane protein FLRT1 FLRT1 UNQ752/PRO1483 Fibronectin-like domain-containing leucine-rich transmembrane protein 1 protein protein human Homo sapiens Human MDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT mint May have a function in cell adhesion and/or receptor signaling flrt2_human Leucine-rich repeat transmembrane protein FLRT2 FLRT2 KIAA0405 UNQ232/PRO265 Fibronectin-like domain-containing leucine-rich transmembrane protein 2 protein protein human Homo sapiens Human MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSYTPPTPTTSKLPTIPDWDGRERVTPPISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT mint May have a function in cell adhesion and/or receptor signaling fgfr1_xenla Fibroblast growth factor receptor 1 fgfr1 fgfra2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MFSGMSLLLWGVLLGAALSVARPPSTLPDEVAPKTKTEVEPYSAQPGDRITLQCRLREDVQSINWVKNGVQLSETNRTRITGEEIQISNAGPEDNGVYACVTNGPSRTYTVLCSVNVSDALPSAEDDDEDDDNSSSEEKAAENSKPNRPLWSHPEKMEKKLHAVPAAKTVKFRCPANGTPTPTLRWLKNNRAFQQDQRIGGYKVRSQTWSLIMDSVVPSDKGNYTCIVENKYGAINHTYQLDVVERSPHRPILQAGLPANTSVTVGTTAEFSCKVYSDPQPHIQWLRHIEINGSRVASDGFPYVEILKTAGVNTSDKDMEVLHLRNVTFEDAGQYTCLAANSIGISHHSAWLTVLKVEDNKPALLASPLQLEIIIYCTGAAFVSAMVVTIIIFKMKHPSKKSDFNSQLAVHKLAKSIPVRRQVTVSGDSSSSMNSGVILVRRLSSSGTPMLSGLSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYTSKGNLREYLRARRPPAMEYCYNPTCVPDQLLSFKDLVSCAYQVARGMDYLASKKCIHRDLAARNVLVTEDNIMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTNCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRILALSSNQEYLDLSMPVNQYSPCFPDTRSSTCSSGEDSMFSHDPLPDEPCLPKYSNGGLKKR mint Receptor for basic fibroblast growth factor flrt3-flrt3-1 337196 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1B mint flrt3-flrt3-2 337196 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1A mint flrt3-flrt1 337196 flrt1_human 337199 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1B mint flrt3-flrt2 337196 flrt2_human 337200 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1B mint flrt3-fgfr1 337196 fgfr1_xenla 337201 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q70ak3_xenla 337198 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell v5 tagged v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1A mint flrt2-flrt2 337197 flrt2_human 337200 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 flrt2_human 337200 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction false false false F1C homomint mint flrt1-flrt2 337197 flrt2_human 337200 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 flrt1_human 337199 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction false false false F1C homomint mint