IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dray-2006-2 Interaction between Arabidopsis Brca2 and its partners Rad51, Dmc1, and Dss1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dray E., Siaud N., Dubois E., Doutriaux MP. Directed yeast two hybrid Figure 2(B), 3(D) and 4(B) doutriau@ibp.u-psd.fr Plant Physiol. (0032-0889) 2006 Only protein-protein interactions imex curation dray-2006-1 Interaction between Arabidopsis Brca2 and its partners Rad51, Dmc1, and Dss1. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Dray E., Siaud N., Dubois E., Doutriaux MP. Directed yeast two hybrid Figure 2(B), 3(D) and 4(B) doutriau@ibp.u-psd.fr Plant Physiol. (0032-0889) 2006 Only protein-protein interactions imex curation rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD rad51_arath DNA repair protein RAD51 homolog 1 RAD51 Rad51-like protein 1 At5g20850 F22D1.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTMEQRRNQNAVQQQDDEETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAYTPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLEGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALLIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAHATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD dmc1_human Meiotic recombination protein DMC1/LIM15 homolog DMC1 DMC1H LIM15 protein protein human Homo sapiens Human MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE brc2a_arath Protein BREAST CANCER SUSCEPTIBILITY 2 homolog A BRCA2A BRCA5(IV) F6N15.14/F6N15.15 At4g00020/At4g00010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTWQLFPDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSMADLLLQGCSKLIAREEAMPGEIPMFRTGLGKSVVLKESSIAKAKSILAEKVTYSDLRNTNCSIPQMRQVDTAETLPMFRTASGKSVPLKESSIAKAMSILGSDKIIDSDNVLPRESGFGVSNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSSQQHGWSGLKTHEEFDATVVKHHSGTPGQYEDYVSGKRSEVLNPSLKVPPTKFQTAGGKSLSVSAEALKRARNLLGDPELGSFFDDVAGGDQFFTPEKDERLSDIAINNGSANRGYIAHEEKTSNKHTPNSFVSPLWSSSKQFSSVNLENLASGGNLIKKFDAAVDETDCALNATHGLSNNRSLASDMAVNNSKVNGFIPRGRQPGRPADQPLVDITNRRDTAYAYNKQDSTQKKRLGKTVSVSPFKRPRISSFKTPSKKHALQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKDFFGMHPTATTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRKWVTNHYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPASSMMVLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGKLFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVPLALNCIKCNGGPVPKTLAGIKRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSALVEGIMCEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKAKFEAAQQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWDPTERQRTELTEGKIYMMKGLVPINSDSEILYLHARGSSSRWQPLSPKDSENFQPFFNPRKPISLSNLGEIPLSSEFDIAAYVVYVGNAYTDVLQKKQWVFVTDGSAQHSGEISNSLLAISFSTSFMDDSSVSHISHNLVGSVVGFCNLIKRAKDVTNEIWVAEAAENSVYFINAEAAYSSHLKTSSAHIQTWAKLSSSKSVIHELRQRVLSIIGACKSPSC dmc1_arath Meiotic recombination protein DMC1 homolog DMC1 LIM15 F5N5.6 At3g22880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMASLKAEETSQMQLVEREENDEDEDLFEMIDKLIAQGINAGDVKKLQEAGIHTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYMTGSDALIKRKSVVKITTGCQALDDLLGGGIETSAITEAFGEFRSGKTQLAHTLCVTTQLPTNMKGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRILIVDSIIALFRVDFTGRGELADRQQKLAQMLSRLIKIAEEFNVAVYMTNQVIADPGGGMFISDPKKPAGGHVLAHAATIRLLFRKGKGDTRVCKVYDAPNLAEAEASFQITQGGIADAKD sem11_arath Protein DELETION OF SUV3 SUPPRESSOR 1(I) DSS1(I) Probable 26S proteasome complex subunit sem1-1 F13O11.6 At1g64750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAEPKAATAEVVKMDLFEDDDEFEEFEINEDWLEKEEVKEVSQQWEDDWDDDDVNDDFSRQLRKELENGTDKK brc2b_arath Protein BREAST CANCER SUSCEPTIBILITY 2 homolog B BRCA2B BRCA2(V) F7A7.150 At5g01630 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTWHLFSDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSMADLLLQGCSKLIEREESMPGEIPMFRTGLGKSVVLKESSIAKAKSILAENVAYSDLQNTNCSIPQTRQVDTAETMPMFRTALGKTVPLKESSIAKPLSILGSDMIIDSDNVLPRESGFGVPNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSLQQHGWSGLKTHEEFDATVVKHHSGTPGQYENYVSGKRSEILNPSLKVPPTKFQTAGGKSLSVSAEALKRARNLLGDPELGSFFDDVAGGDQFFTPQKDERLSDIAINNGSVNTGYIAHEEKTSNKHTSNSFVSPLHSSSKQFRSVNLENLASGGNLIKKFDTAVDETNCALNISKPATHGLSNNRPLASDMAVNNSKGNGFIPRARQLGRPADQPLVDITNRRDTAYANNKQDSTQKKRLGKTVSVSPFKRPRISSFKTPLKKNAQQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKEFFGMHPTATTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRKWVTNHYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPASSMMVLCISAINPRTDNGSQEAHCSDNCSNVKVELTDGWYSMNAALDVVLTKQLNAGKLFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIGVPLAFNCIKCNGGPVPKTLAGITRIYPILYKERLGEKKSIVRSERIESRIIQLHNQRRSALVEGIMCEYQRGINGVHSQNDTDSEEGAKVFKLLETAAEPELLMAEMSLEQLTSFTTYKAKFEAAKQMQMEKSVAKALEDAGLGERNVTPFMRIRLVGLTSLSNEGEHNPKEGIVTIWDPTERQRTELTEGKIYIMKGLVPMNSDSETLYLHARGSSSRWQPLSPKDSENFQPFFNPRKPISLSNLGEIPLSSEFDIAAYVVYVGDAYTDVLQKKQWVFVTDGSTQHSGEISNSLLAISFSTPFMDDSSVSHISHNLVGSVVGFCNLIKRAKDATNEMWVAETTENSVYFINAEAAYSSHLKTRSAHIQTWAKLYSSKSVIHELRQRVLFIIGACKSPSC sem12_arath Protein DSS1 HOMOLOG ON CHROMOSOME V DSS1(V) Probable 26S proteasome complex subunit sem1-2 K21C13.20 At5g45010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAEPKAAVEVVKVDLFEDDDEFEEFEINEDWLEKEEVKEVSLQWEDDWDDDDVSDDFSRQLKKELENASEKK rad51-rad51-5 Yeast 2 hybrid analysis reveals interaction between arabidopsis RAD51 protein and human RAD51 protein 366053 N/A 366055 unspecified role unspecified role prey prey N/A 366056 unspecified role unspecified role bait bait physical association physical association false false false rad51-dmc1 Yeast 2 hybrid analysis reveals interaction between arabidopsis RAD51 protein and human DMC1 protein 366053 N/A 366057 unspecified role unspecified role prey prey N/A 366056 unspecified role unspecified role bait bait physical association physical association false false false f6n15_14-dmc1-2 Yeast 2 hybrid analysis reveals interaction between arabidopsis F6n15.14 protein and human DMC1 protein 366053 N/A 366057 unspecified role unspecified role prey prey N/A 366058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f6n15_14-rad51 Yeast 2 hybrid analysis reveals interaction between arabidopsis F6n15.14 protein and human RAD51 protein 366053 N/A 366055 unspecified role unspecified role prey prey N/A 366058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f6n15_14-dmc1-3 Yeast 2 hybrid analysis reveals interaction between F6n15.14 protein and DMC1 protein 366053 N/A 366059 unspecified role unspecified role prey prey N/A 366058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f6n15_14-rad51-3 Yeast 2 hybrid analysis reveals interaction between F6n15.14 protein and RAD51 protein 366053 N/A 366058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 366056 unspecified role unspecified role prey prey physical association physical association false false false f6n15_14-dss1 Yeast 2 hybrid analysis reveals interaction between F6n15.14 protein and Dss1 (At1g64750) protein 366053 N/A 366060 unspecified role unspecified role prey prey N/A 366058 unspecified role unspecified role bait bait physical association physical association false false false brca2b-dss1 Yeast 2 hybrid analysis reveals interaction between the BRCA2b protein and Dss1 (At1g64750) protein 366053 n/a 366061 unspecified role unspecified role bait bait N/A 366060 unspecified role unspecified role prey prey physical association physical association false false false brca2b-dss5 Yeast 2 hybrid analysis reveals interaction between the BRCA2b protein and Dss5 (At5g45010) protein 366053 n/a 366061 unspecified role unspecified role bait bait N/A 366062 unspecified role unspecified role prey prey physical association physical association false false false brca2b-rad51-3 Y2H reveals interaction between the BRCA2b protein and RAD51 protein 366053 n/a 366061 unspecified role unspecified role bait bait N/A 366056 unspecified role unspecified role prey prey physical association physical association false false false brca2b-dmc1-4 Y2H reveals interaction between the BRCA2b protein, Dss1 (At1g64750) and DMC1 protein 366053 n/a 366061 unspecified role unspecified role prey prey N/A 366059 unspecified role unspecified role bait bait physical association physical association false false false brca2b-rad51-4 Yeast 2 hybrid analysis reveals interaction between arabidopsis BRCA2b protein and human RAD51 protein 366053 N/A 366055 unspecified role unspecified role prey prey n/a 366061 unspecified role unspecified role bait bait physical association physical association false false false brca2b-dmc1-5 Yeast 2 hybrid analysis reveals interaction between BRCA2b protein and DMC1 protein 366053 n/a 366061 unspecified role unspecified role bait bait N/A 366059 unspecified role unspecified role prey prey physical association physical association false false false f6n15_14-dmc1-1 Coimmunoprecipitation analysis reveals interaction between the F6N15.14 protein and DMC1 protein 366054 N/A 366059 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366058 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Although AtBrca2(IV) is mapped to the correct protein according to TAIR, the protein should be 1151 amino acids long, not 765 (O81303.1). Deletion mutant information has been lost since mutant is longer than the current protein sequence. Residues 1-784 AtBrca2(IV) (O81303) are sufficient to bind f6n15_14-rad51-2 Coimmunoprecipitation analysis reveals interaction between the F6N15.14 protein and RAD51 protein 366054 N/A 366056 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Although AtBrca2(IV) is mapped to the correct protein according to TAIR, the suthors state that the protein should be 1151 amino acids long, not 765 (O81303.1). Deletion mutant information has been lost since mutant is longer than the current protein sequence. Residues 1-784 AtBrca2(IV) (O81303) sufficient to bind brca2b-rad51-1 Coimmunoprecipitation reveals interaction between the BRCA2b protein and RAD51 protein 366054 N/A 366056 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 366061 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false brca2b-dmc1-2 Coimmunoprecipitation reveals interaction between the BRCA2b protein and DMC1 protein 366054 n/a 366061 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366059 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false rad51-dmc1-2 Coimmunoprecipitation analysis reveals interaction between the RAD51 protein and DMC1 protein 366054 N/A 366059 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366056 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false dmc1-rad51 Coimmunoprecipitation analysis reveals interaction between the DMC1 protein and RAD51 protein 366054 N/A 366059 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366056 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6n15_14-dss1-1 Coimmunoprecipitation analysis reveals interaction between the F6N15.14 protein and Dss1 (At1g64750) protein 366054 N/A 366060 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Although AtBrca2(IV) is mapped to the correct protein according to TAIR, the protein should be 1151 amino acids long, not 765 (O81303.1). Deletion mutant information has been lost since mutant is longer than the current protein sequence. Residues 1-784 AtBrca2(IV) (O81303) are sufficient to bind brca2b-dss1-1 Coimmunoprecipitation reveals interaction between the BRCA2b protein and Dss1 (Ar1g64750) protein 366054 n/a 366061 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366060 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false brca2b-dss5-1 Coimmunoprecipitation reveals interaction between the BRCA2b protein and Dss5 (At5g45010) protein 366054 n/a 366061 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366062 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false brca2b-rad51-2 Coimmunoprecipitation reveals interaction between the BRCA2b protein, Dss1 (At1g64750)and RAD51 protein 366054 N/A 366060 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366056 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 366061 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false brca2b-dmc1-3 Coimmunoprecipitation reveals interaction between the BRCA2b protein, Dss1 (At1g64750) and DMC1 protein 366054 N/A 366060 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 366061 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366059 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false