IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ czaplinski-2006-1 40LoVe interacts with Vg1RBP/Vera and hnRNP I in binding the Vg1-localization element. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Czaplinski K., Mattaj IW. czaplins@aecom.yu.edu RNA (1355-8382) 2006 Only protein-protein interactions imex curation czaplinski-2006-2 40LoVe interacts with Vg1RBP/Vera and hnRNP I in binding the Vg1-localization element. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Czaplinski K., Mattaj IW. czaplins@aecom.yu.edu RNA (1355-8382) 2006 Only protein-protein interactions imex curation czaplinski-2006-3 40LoVe interacts with Vg1RBP/Vera and hnRNP I in binding the Vg1-localization element. xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Czaplinski K., Mattaj IW. czaplins@aecom.yu.edu RNA (1355-8382) 2006 Only protein-protein interactions imex curation czaplinski-2006-4 40LoVe interacts with Vg1RBP/Vera and hnRNP I in binding the Vg1-localization element. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Czaplinski K., Mattaj IW. czaplins@aecom.yu.edu RNA (1355-8382) 2006 Only protein-protein interactions imex curation ptbp1_human Polypyrimidine tract-binding protein 1 PTBP1 PTB Heterogeneous nuclear ribonucleoprotein I 57 kDa RNA-binding protein PPTB-1 protein protein human Homo sapiens Human MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI q7zye9_xenla hnrnpab.L hnrnpab protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSDTEQQCLETNAENGHEACDAEAAEDKAPAGQNGAEGEQINASKGEEDAGCVADISSPLTEGVKMFVGGLSWDTSKKDLKDYFAKFGEVSDCTIKMDPNTGRSRGFGFILFKDAESVDKVLEHKEHRLDGRLIDPKKAMAMKKDPIKKIFVGGLNPEAGEDQIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEDPVKKILEKKFHNVSGSKCEIKIAQPKEVYQQQYGGRGGSFGGRGGRGGKGQGQNWNQGYNYWNQGYGNQGYGGYGQQGYGGYGNYDYSGYGYYGYGPGYDYSQGSANYGKAPRRGSHQNNYKPY ptbp1-hnrpab-2 540042 N/A 540046 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 540047 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 4B the proteins were identified by size after SDS-PAGE electrophoresis ptbp1-hnrpab-3 540043 N/A 540046 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 540047 unspecified role unspecified role prey prey N/A 540047 unspecified role unspecified role bait bait association association false false false 3A ptbp1-hnrpab-4 540044 N/A 540046 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 540047 unspecified role unspecified role prey prey N/A 540047 unspecified role unspecified role bait bait palmitoylation palmitoylation reaction palmitoylation false false false 3C ptbp1-hnrpab 540045 N/A 540047 unspecified role unspecified role prey prey in vitro In vitro N/A 540046 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 4A