MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint de_iaco-2006-1 Huckebein-mediated autoregulation of Glide/Gcm triggers glia specification. in vitro In vitro pull down pull down predetermined predetermined participant predetermined De Iaco R., Soustelle L., Kammerer M., Sorrentino S., Jacques C., Giangrande A. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation de_iaco-2006-2 Huckebein-mediated autoregulation of Glide/Gcm triggers glia specification. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined De Iaco R., Soustelle L., Kammerer M., Sorrentino S., Jacques C., Giangrande A. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation q9vn10_drome hkb CG9768 5953 Dmel\CG9768 HKB Hkb anon-82B3 gurt Dmel_CG9768 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYGY gcm_drome Transcription factor glial cells missing gcm CG12245 Protein glide protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVLNGMPITMPVPMPVPMPVPSPPATKSRVAIDWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGASVHLRPAICDKARRKQQGKQCPNRNCNGRLEIQACRGHCGYPVTHFWRRDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLRPTKRQAKTQSIQESKRRRMGASDVLETKQELVVPPTTYLPTSTPTHSTNFNQSQGSYVPAGQGSVISQWNREIHYETEDPCYANGMYSYDMLHSPLSAHSSTGSYYQENKPQQLQHSQYQQQLSPQQHVPVSYDPSQPISSSLQCGMPSYEICDDTSSLTSSSGYCSEDYGYYNGYLPNSLDVSNGSQSQNLSQDASFYTTSSEIFSVFESTLNGGGTSGVDLIYDEATAYQQHQQQGTFPHLTNYQQEPQDQMQSADYYYSNTGVDNSWNIQMDATYHPVNSTDPIYC hkb-gcm 492672 q9vn10_drome 492674 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 gcm_drome 492675 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F4C F4E mint gcm-hkb 492673 q9vn10_drome 492674 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 gcm_drome 492675 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false SF1 mint