IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tonaco-2006-4 In vivo imaging of MADS-box transcription factor interactions. viguu Vigna unguiculata subsp. unguiculata (Cowpea) Vigna sinensis fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation tonaco-2006-1 In vivo imaging of MADS-box transcription factor interactions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation tonaco-2006-2 In vivo imaging of MADS-box transcription factor interactions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation tonaco-2006-3 In vivo imaging of MADS-box transcription factor interactions. viguu Vigna unguiculata subsp. unguiculata (Cowpea) Vigna sinensis fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation agl9_pethy Agamous-like MADS-box protein AGL9 homolog Floral homeotic protein FBP2 Floral-binding protein 2 FBP2 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITVGGAGPSVNNYMAGWLP fbp24_pethy MADS-box protein FBP24 FBP24 Floral-binding protein 24 protein protein pethy Petunia hybrida (Petunia) MIIMGRGKIEVKRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSKGKLFEYCSQPHSMSQIISRYLQTTGASLPVEDNRVQLYDEVAKMRRDTLNLQLSLQRYKGDDLSLAQYEELNELEKQLEHALNKIRARKLELMQQQMENLKKTEKMLEKENHDMYQWLMNNQMYKQESAAMDHEDHHHHHEHQQAITELNLLGEQPLLSHFTFFGDQEQPSTSTVNHFASISLTSPPANSISPYRLQPSHPNLQDSHVHGPSYD q40882_pethy fbp11 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYANNNIKGTIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQLLQNTNRHLVGEGLSALNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENTFLRSKIAENERLQELSMMPATGQEYNAFQQYFARNMLQLNMMEGGVPSYDPLPAHDKKSLQLE q9atf3_pethy FBP4 protein protein pethy Petunia hybrida (Petunia) MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMSTTLEKYHRYCYGALEGSQPSTDSQNIYQEYLKLKTRVEALQQSQRHMLGADLGQLGTKDLEQLERQLDSSLRQIRSTRTQNMLDQLSELQEKQEQSLIEMNKSLRMKLEELGVAFQTSMHSGEESVQYRQQPAEPEGLFHPVECNNSLPIRYNTLPREHVVPSAQDSTGVLPGWML q43616_pethy fbp7 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNNNIRAIIDRYKKATVETSNAFTTQELNAQFYQQESKKLRQQIQLIQNSNRHLVGEGLSSLNVRELKQLENRLERGIARIRSKKHEMILAESEDLQKREIQLEQENAFLRSKIAENERLQELSMMPAGGQEYNAIQQYLARNMLQLNMMEGVPSYPLPSDKKSLDLE fbp24-fbp2-2 FRET analysis reveals interaction between the FBP24 protein and FBP2 protein 496548 N/A 496552 unspecified role unspecified role neutral component neutral component c terminal cyan fluorescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 496553 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 2 M - O The proteins colocalised to the nucleus fbp24-fbp11-2 FRET analysis reveals interaction between the FBP24 protein and FBP11 protein 496548 N/A 496553 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 496554 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 2 P - R A distrbution of different fluorescence lfetime values over the nucleus was observed, suggesting sub-nuclear regions with and without interaction between the proteins. fbp24-fbp24 FRET analysis reveals homotypic interaction of the FBP24 protein 496548 N/A 496553 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 496553 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 2 S - U A distrbution of different fluorescence lfetime values over the nucleus was observed, suggesting sub-nuclear regions with and without interaction between the proteins. fbp2-fbp11-2 FRET analysis reveals interaction between the FBP2 protein and FBP11 protein 496548 N/A 496554 unspecified role unspecified role neutral component neutral component c terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 496554 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 2 J - L The proteins localised to the nucleus. fbp24-fbp2 Directed Yeast 2 hybrid analysis reveals interaction between the FBP24 protein and FBP2 protein 496549 N/A 496552 unspecified role unspecified role prey prey N/A 496553 unspecified role unspecified role bait bait physical association physical association false false false fbp24-fbp4 Directed Yeast 2 hybrid analysis reveals interaction between the FBP24 protein and FBP4 protein 496549 N/A 496555 unspecified role unspecified role prey prey N/A 496553 unspecified role unspecified role bait bait physical association physical association false false false fbp24-fbp11 Directed Yeast 2 hybrid analysis reveals interaction between the FBP24 protein and FBP11 protein 496550 N/A 496554 unspecified role unspecified role prey prey N/A 496552 unspecified role unspecified role ancillary ancillary N/A 496553 unspecified role unspecified role bait bait physical association physical association false false false Table 1. The interaction was described as weak and could be deteced at room temperature and low concentrations of 3AT (1mM). The authors describe the FBP2 protein as having its Cterminal domain deleted but do not give the precise coordinates of the region deleted. fbp24-fbp7 Directed Yeast 2 hybrid analysis reveals interaction between the FBP24 protein and FBP7 protein 496550 N/A 496552 unspecified role unspecified role ancillary ancillary N/A 496553 unspecified role unspecified role bait bait N/A 496556 unspecified role unspecified role prey prey physical association physical association false false false Table 1. The interaction was described as weak and could be deteced at room temperature and low concentrations of 3AT (1mM). The authors describe the FBP2 protein as having its Cterminal domain deleted but do not give the precise coordinates of the region deleted. fbp24-fbp2-1 Colocalisation analysis reveals interaction between the FBP24 protein and FBP2 protein 496551 N/A 496552 unspecified role unspecified role neutral component neutral component c terminal yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 496553 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 1 F The proteins colocalised to the nucleus fbp24-fbp11-1 Colocalisation analysis reveals interaction between the FBP24 protein and FBP11 protein 496551 N/A 496553 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 496554 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 1 J