IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mische-2005-1 Retroviral restriction factor TRIM5alpha is a trimer. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mische CC., Javanbakht H., Song B., Diaz-Griffero F., Stremlau M., Strack B., Si Z., Sodroski J. HEK-293T cells transiently expressing the TRIM5-alpha variants were lysed and cross-linked with different concentrations (mM) of glutaraldehyde and ethylene glycolbis(succinimidylsuccinate). This was followed by anti-tag CoIP. 2 joseph_sodroski@dfci.harvard.edu J. Virol. (0022-538X) 2005 mische-2005-2 Retroviral restriction factor TRIM5alpha is a trimer. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mische CC., Javanbakht H., Song B., Diaz-Griffero F., Stremlau M., Strack B., Si Z., Sodroski J. HEK-293T cells transiently expressing the TRIM5-alpha variants were lysed and cross-linked with different concentrations (mM) of glutaraldehyde and ethylene glycolbis(succinimidylsuccinate). This was followed by anti-tag CoIP. 2 joseph_sodroski@dfci.harvard.edu J. Virol. (0022-538X) 2005 q0pf16-2 Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWGKEKSHYHQPPCGLSLLLSLSFRILYSLLGLVF No experimental confirmation available. trim5_macmu Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS trim5_chlae Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MASGILLNVKEEVTCPICLELLTEPLSLPCGHSFCQACITANHKESMLYKEEERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRVENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSYQNPQIMYQAPGSSFGSLTNFNYCTGVLGSQSITSRKLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDATYNIEQNENYQPKYGYWVIGLQEGDKYSVFQDSSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS q2y080_aotaz Peptidyl-prolyl cis-trans isomerase protein protein aotaz Aotus azarai (Southern owl monkey) Aotus azarae MVNPTVFFDIAVDGEPLGRVSFELFADKLPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTPHNGTGGKSIYGVKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNVVEAMERFGCRYGKTSKKITIADCGQL trim5 363418 n/a 363420 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spry motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Higher oligomers are observed. Deletions of 1-93 and 1-132 showed the presence of dimers, trimers and higher oligomers. These were more evident under reduced conditions induced by the use of beta-Mercaptoethanol. The TRIM5-alpha isoform was used. trim5-1 363418 N/A 363421 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 3.0 direct interaction direct interaction false false false Higher oligomers were observed. The TRIM5-alpha isoform was used. trim5-2 363418 N/A 363421 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false The TRIM5-gamma isoform was used. trim5-4 363418 N/A 363422 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 direct interaction direct interaction false false false Some dimers and higher oligomers were also observed. trim5-5 363418 N/A 363423 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 direct interaction direct interaction false false false Some trimers were observed however the majority were higher oligomer fraction. trim5-3 363419 N/A 363421 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 3.0 direct interaction direct interaction false false false The TRIM5-alpha isoform was used. Mainly trimers and higher oligomers were observed in the presence of glutaraldehyde while dimers and trimers were observed in the presence of ethylene glycolbis(succinimidylsuccinate).