UniProt UniProt http://www.uniprot.org asakawa-2005-1 Dissociation of the Nuf2-Ndc80 complex releases centromeres from the spindle-pole body during meiotic prophase in fission yeast. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Asakawa H., Hayashi A., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp Mol. Biol. Cell (1059-1524) 2005 asakawa-2005-2 Dissociation of the Nuf2-Ndc80 complex releases centromeres from the spindle-pole body during meiotic prophase in fission yeast. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Asakawa H., Hayashi A., Haraguchi T., Hiraoka Y. yasushi@nict.go.jp Mol. Biol. Cell (1059-1524) 2005 nuf2_schpo Kinetochore protein nuf2 NMS complex subunit nuf2 nuf2 SPAC27F1.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MARKHTFPSLKRAEILECIDGLGIPFTAKELDQPTSKAVIPLYEEFLDLFMGLTRQNLEEKVNSLQDSVENFEIIHESLRFTVFYQILSQFMQNICFHDFTIQDLLKPDRNRLQLILSAVINFAKLREERLQQFDDDIQKRESLLETYTLLDAQRKDLEEKVLLSQDRKLESEAIIKQNEERNEEMFQSLIEDKRLCSQVRTEYDRIRMEASELKIRYHNVDSLMASTLEEIEKLQSSIVHSPEKLKGKIADTSLRIQNDRSQQVELDKKSKILHTKLNSLQLIEGDLNACLKVLEECLVELDKLEHATVLLSTNQELCDQIEINKKKLEFRKEQLLKQLSNAQEKLEHEQHSRNQKLEAAKQRMDNIREEYKVITQERNKKIQETEKKNAMIEMTEQKIAGMREELESQISSITMEFEKLKSHVELYIAELLRNLRSSNS D716FE83223BD16E ndc80_schpo Kinetochore protein ndc80 NMS complex subunit ndc80 ndc80 ndc10 tid3 SPBC11C11.03 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQDSSSYARRYSQAPSSSNLRTTTFGFNGLGTSRTSLAPQRTLVNARQSIDPDGLSSRVLTPTMRPSLAPNTRRSSVRVSNASFISQTPNITSIKDPRPLSDRRYQQECATQVVNYLLESGFSQPLGLNNRFMPSTREFAAIFKHLYNKLDPNFRFGARYEEDVTTCLKALNYPFLDSISRSRLVAIGSPHVWPAILGMLHWVVSLIQCTEKAVAMVYTVEQNSLDDHLVDKVLFDYLVRTYHLYLDESPEESEPEKELKATFNQQNQDLYNQTEALKSTNEELINQIKSAEELDSAIQVLEERYRTMQRDEVKFQSAMSGMKSKMESRTNLMKQLQVNIEEKESQLQLLKEKRDSLKYQVENQDISISEFEKMVSEREQLDRNLNMIGSKISELRKEVFDTDLLIQASIDSLEKKVQKFNSLAYRIGIVPIAAIRSANNDFELEINPEGPNYINLDLKNKVRPFINEVRRSITLEFHEEQNKSLKLQEHVDTVNDLIAELQDELRGIESRLTSVLSECNMLRETASEEKNAFDAESDKLERELQQLKLSSHNSMLQLDQRIQSINIEADQIAHACMEYKNNIYKEVAFVLGEIIHFKLHVQDSLEDLKMDYQKELDDLSRSEL spc24_schpo Kinetochore protein spc24 spc24 SPBC336.08 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSDSPIELMRSTLAGFQIAPDVKTISNIQDIRAQIQSFREKELEGSQTKFKVLSRKLEISTQAMESLKQTAESSQHAEEILSREKEKFRIAKLLNITENEIMSLESQLQKMKEQLLQLEERENTSEDICQSEENANMLKLNFYHSLGFDLETAENTGNKRVIIHTENDLQTVQISNKYSPYFYSNYFWDLLDDSKDKK spc25_schpo Kinetochore protein spc25 spc25 SPCC188.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSLANFPTIELDYDSLKSKISNFNSIFDRFLQEERKKLLNNKNEYLRQLSEINEAQKKAEKSLEQTEARKQNFTELLEKEHEEQAITEQEIFSFQEKLDAMLKRKQKLSEELDHYRAIISSKRELRAQEMEAKRKQDSYNNPELKFWEDYLGLKMEGVHDEVIRFIFTNIDEKDWNKQFSFQINLAERDYKVVHCHPPLPHVDDLVNKVNRTRDFYQFLKDMRKGFRELHRKDLSQLI mis12_schpo Centromere protein mis12 NMS complex subunit mis12 mis12 SPBC409.04c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLVELLEFTPLSFIDDVINITNQLLYKGVNGVDKAFSQTRFAKKAPQEIEEGLHKFEVLFESVVDRYYDGFEVYTLRNIFSYPPELKGYMRTFGKDVDYSITTEQDAAMDQAIQEAAEKLVVKMQLRRDLRMRLSRKREKKTEIEKHLERISFLNKVPENWQVTLPETTDFLLDQLGNLQHAVKRVVEASPTVHSREVDERITYLEKGYERLSNPIDQQKDFWSHHLSKLESTANTETANNIHKLLLSSEKDVGHTDEP nuf2_nuf2_1 508377 N/A 508379 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508379 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A nuf2_ndc80_2 508377 N/A 508379 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508380 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A ndc80_nuf2_8 508377 N/A 508379 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508380 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A ndc80_spc24_1 508377 N/A 508381 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508380 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A spc24_ndc80_2 508377 N/A 508380 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508381 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A spc24_spc24_1 508377 N/A 508381 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508381 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A spc24_spc25_2 508377 N/A 508382 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508381 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A spc25_spc24_1 508377 N/A 508381 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508382 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A ndc80_nuf2_9 508378 N/A 508379 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508380 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2B ndc80_spc24_2 508378 N/A 508381 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508380 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2B ndc80_spc25_1 508378 N/A 508382 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508380 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2B mis12_nuf2_1 508378 N/A 508383 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508379 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4D