IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kato-2004-5 Characterization of heterotrimeric G protein complexes in rice plasma membrane. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kato C., Mizutani T., Tamaki H., Kumagai H., Kamiya T., Hirobe A., Fujisawa Y., Kato H., Iwasaki Y. This experiment relates to a negative interaction. iwasaki@fpu.ac.jp Plant J. (0960-7412) 2004 Only protein-protein interactions imex curation In some assays plama membranes from a mutant rice plants carrying a constitutively active form of the GPA1 protein (GPA1 Q223L) were analysed. The UniProt accession number for RGG2 was determined from the amino acid sequence given in Figure 1 of this paper using a amino acid similarity search against the UniProt database. kato-2004-6 Characterization of heterotrimeric G protein complexes in rice plasma membrane. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kato C., Mizutani T., Tamaki H., Kumagai H., Kamiya T., Hirobe A., Fujisawa Y., Kato H., Iwasaki Y. This experiment relates to a negative interaction iwasaki@fpu.ac.jp Plant J. (0960-7412) 2004 Only protein-protein interactions imex curation In some assays plama membranes from a mutant rice plants carrying a constitutively active form of the GPA1 protein (GPA1 Q223L) were analysed. The UniProt accession number for RGG2 was determined from the amino acid sequence given in Figure 1 of this paper using a amino acid similarity search against the UniProt database. gbb_orysj Guanine nucleotide-binding protein subunit beta RGB1 WD40 repeat-containing protein 80 OSJNBa0039O18.9 LOC_Os03g46650 Os03g0669200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MASVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTADVLSLSINSSNSNMFVSGSCDATVRLWDIRIASRAVRTYHGHEGDINSVKFFPDGQRFGTGSDDGTCRLFDVRTGHQLQVYSREPDRNDNELPTVTSIAFSISGRLLFAGYSNGDCYVWDTLLAEVVLNLGNLQNSHEGRISCLGLSSDGSALCTGSWDKNLKIWAFSGHRKIV gpa1_orysj Guanine nucleotide-binding protein alpha-1 subunit GPA1 D1 GA1 RGA1 OJ1005_D04.15 OSJNBa0049D13.1 Protein Dwarf1 LOC_Os05g26890 Os05g0333200 Protein Daikoku dwarf protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGSSCSRSHSLSEAETTKNAKSADIDRRILQETKAEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELRSYTSVIHANVYQTIKILYEGAKELSQVESDSSKYVISPDNQEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQETYLRGSILQLPDCAQYFMENLDRLAEAGYVPTKEDVLYARVRTNGVVQIQFSPVGENKRGGEVYRLYDVGGQRNERRKWIHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETKELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKVPLSVCEWFKDYQPIAPGKQEVEHAYEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT gbb-gpa1-1 GPA1 does not interact with GBB 541722 N/A 541724 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 541725 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false true 5a Both proteins were labelled with 35S-methionine and 35S-cysteine The interaction does not occur under these experimental conditions gbb-gpa1-2 GPA1 does not interact with GBB 541723 N/A 541724 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 541725 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false true 5a Both proteins were labelled with 35S-methionine and 35S-cysteine The interaction does not occur under these experimental conditions