IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hao-2004-3 Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hao Z., Jha KN., Kim YH., Vemuganti S., Westbrook VA., Chertihin O., Markgraf K., Flickinger CJ., Coppola M., Herr JC., Visconti PE. Yeast 2-hybrid data further quatified by measurement of alpha-galactosidase activity. 5A-C pvisconti@vasci.umass.edu Mol. Hum. Reprod. (1360-9947) 2004 hao-2004-2 Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm. in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Hao Z., Jha KN., Kim YH., Vemuganti S., Westbrook VA., Chertihin O., Markgraf K., Flickinger CJ., Coppola M., Herr JC., Visconti PE. Yeast 2-hybrid data further quatified by measurement of alpha-galactosidase activity. 5A-C pvisconti@vasci.umass.edu Mol. Hum. Reprod. (1360-9947) 2004 hao-2004-1 Expression analysis of the human testis-specific serine/threonine kinase (TSSK) homologues. A TSSK member is present in the equatorial segment of human sperm. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hao Z., Jha KN., Kim YH., Vemuganti S., Westbrook VA., Chertihin O., Markgraf K., Flickinger CJ., Coppola M., Herr JC., Visconti PE. Yeast 2-hybrid data further quatified by measurement of alpha-galactosidase activity. 5A-C pvisconti@vasci.umass.edu Mol. Hum. Reprod. (1360-9947) 2004 tssk2_human Testis-specific serine/threonine-protein kinase 2 Serine/threonine-protein kinase 22B DiGeorge syndrome protein G TSSK2 DGSG SPOGA2 STK22B protein protein human Homo sapiens Human MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTGLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAST q9ujt2-2 Testis-specific serine kinase substrate TSKS STK22S1 TSKS1 STK22 substrate 1 protein protein human Homo sapiens Human MGDSCPAVTFRSQKENRAGLQEKLRYLQQQLQDETPRRQEAELQEPEEKQEPEEKQKPEAGLSWNSLGPAATSQGCPGPPGSPDKPSRPHGLVPAGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ tsks_human Testis-specific serine kinase substrate STK22 substrate 1 TSKS STK22S1 TSKS1 protein protein human Homo sapiens Human MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKKKAVSFHGVEPQMSHQPMHWCLNLKRSSACTNVSLLNLAAMEPTDSTGTDSTVEDLSGQLTLAGPPASPTLPWDPDDADITEILSGVNSGLVRAKDSITSLKEKTNRVNQHVQSLQSECSVLSENLERRRQEAEELEGYCIQLKENCWKVTRSVEDAEIKTNVLKQNSALLEEKLRYLQQQLQDETPRRQEAELQEPEEKQEPEEKQEPEEKQKPEAGLSWNSLGPAATSQGCPGPPGSPDKPSRPHGLVPAGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ tssk2-1 Autophosphorylation of TSSK2 demonstrated in vitro 329233 n/a 329236 putative self putative self putative self putative self ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Autophosphorylation of TSSK2 tssk2-2 Autophosphorylation of TSSK2 demonstrated in vitro 329233 n/a 329236 putative self putative self putative self putative self yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false true false Autophosphorylation of TSSK2 tssk2-tsks-1 Phosphorylation of TSKS by TSSK2 demonstrated in vitro 329233 N/A 329237 enzyme target enzyme target substrate substrate unspecified role unspecified role region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 329236 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false false false Phosphorylation of TSKS tssk2-tsks-2 Phosphorylation of TSKS by TSSK2 demonstrated in vitro 329233 N/A 329236 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 329237 enzyme target enzyme target substrate substrate unspecified role unspecified role region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Phosphorylation of TSKS tssk2-stk22s1-2 Interaction between TSSK2 and TSKS identified by pulldown 329234 N/A 329238 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 329236 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false tssk2-stk22s1-3 Interaction between TSSK2 and TSKS identified by pulldown 329234 N/A 329238 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 329236 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false tssk2-stk22s1-1 Interaction between TSSK2 and TSKS identified by yeast 2-hybrid 329235 N/A 329236 unspecified role unspecified role bait bait N/A 329238 unspecified role unspecified role prey prey physical association physical association false false false