IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fien-2004-1 Primer utilization by DNA polymerase alpha-primase is influenced by its interaction with Mcm10p. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fien K., Cho YS., Lee JK., Raychaudhuri S., Tappin I., Hurwitz J. Purified proteins were combined and incubated, then mixed with anti-Flag M2 antibody-agarose beads. Proteins bound were analyzed by SDS-PAGE molecular weight determination. 1 and 2 j-hurwitz@ski.mskcc.org J. Biol. Chem. (0021-9258) 2004 fien-2004-3 Primer utilization by DNA polymerase alpha-primase is influenced by its interaction with Mcm10p. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fien K., Cho YS., Lee JK., Raychaudhuri S., Tappin I., Hurwitz J. Purified proteins were combined and incubated, then mixed with anti-Flag M2 antibody-agarose beads. Proteins bound were analyzed by SDS-PAGE molecular weight determination. 1 and 2 j-hurwitz@ski.mskcc.org J. Biol. Chem. (0021-9258) 2004 fien-2004-2 Primer utilization by DNA polymerase alpha-primase is influenced by its interaction with Mcm10p. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Fien K., Cho YS., Lee JK., Raychaudhuri S., Tappin I., Hurwitz J. Purified proteins were combined and incubated, then mixed with anti-Flag M2 antibody-agarose beads. Proteins bound were analyzed by SDS-PAGE molecular weight determination. 1 and 2 j-hurwitz@ski.mskcc.org J. Biol. Chem. (0021-9258) 2004 dpoa_schpo DNA polymerase alpha catalytic subunit swi7 SPAC3H5.06c pol1 DNA polymerase I protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MRKRNAGIKPSQRFAELRALRQAGKTRASTYESKENEELYDNVSEEEYRKIVRQRLDEDDFVVDDNGAGYVDNGYDEWDQSHYSDEDDENEKGSSGRKRKKSKNVLAEPNQQIGAFFKANAIQPASRIANRKNNEKEDEFMAEILGSIDQDIPERLSTKKGNRSHTTSNAKRRSQKAASSISTTNVVSSDPKKYIPETVPSTPQPASSLPIPSSPPAALETEENVDSQPMELDEPELPVGSDAPIIDVEESIAMKPLMSHDQVDDTASLSKATISQQPLSPMTPLSSELDVSAFSEINSKIKNVDVPASSYSSPISKVSPSDVTEEDGSLFFFWMDYTEMYGSLCLFGKVYDKATKQYVSCFLKVDGIMRSLYFLPRPSSSSVSEDSIAAQTKDVYDEVANLLSKRGVKEWKSRVSKYKYAFELEDVPRTADYLEVIYSYSYPALPTDLTGSSFSHVFGTNTALFEQFVLSRRVMGPCWLKIQQPNFDAVKNASWCRVEIGCSSPQNISVSFEKNEITSKTPPMTVMSLAFRTLINKEQNKQEVVMISARIFENVDIEKGLPANDMPSYSFSLIRPLKQIFPNGFEKLARQHKSSIFCERSEVSLLNNFLNKVRTYDPDVYFGHDFEMCYSVLLSRLKERKIHNWSSIGRLRRSEWPRSFNRSSQQFVEKQIIAGRLMCDLSNDFGRSMIKAQSWSLSEIVLKELDIKRQDINQEKALQSWTDTAHGLLDYLVHCEIDTFFIAAVAFKIQMLQLSKNLTNIAGNSWARTLTGTRAERNEYILLHEFKKNGYIVPDKQQSIRRHAEAFGAEDGLQEESLGKKKDKYKGGLVFEPQKGLYETCILVMDFNSLYPSIIQEYNICFTTVDRSPSNSDSDDQIPDTPSASANQGIFPRLIANLVERRRQIKGLLKDNSATPTQRLQWDIQQQALKLTANSMYGCLGYTKSRFYARPLAVLITYKGREALMNTKELADQMGLQVIYGDTDSVMLNTNVTDKNHALRIGNEFKEKVNERYSKLEIDIDNVYQRMLLHAKKKYAALQLDSQGKPNLDVKGLDMKRREFCTLAKEASKFCLDQILSGELTETVIENIHSYLMDFSEKMRNGKFPANKFIIFNRLGKNPEDYPNGKTMPFVQVALKKKARGENVRVGDVIPFIIAGSDADGHPADRAYSPQEIMNTNSTLVIDYNYYLSHQILPPIERVIAPIEGTNRARLAECLGLDARKYYSHETSESSAFQRYESTLTDDQCFINVSPLLLKCPSCNATSFSLRSVKSLKETLYANTVECDCGYEYSDFTIILQFSSQLRDFINLYYEGILVCDDSSCGNRTRQMSVYGKRCCNKSCRGSVHFEYNDEQLYNQIKFLLKAVQTTTGATRNGIIRCNAINKNISRIMNKNAREFVDMGLIFSS dpoa2_schpo DNA polymerase alpha subunit B SPCC553.09c pol12 spb70 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEFPIDDEELLDERNKLLQICNMDEQTMFYKWESWCLQRGNTPKLDLDTFKAFAKDMKFQMERQVKATLKQNPERKSIKQIPGMNIDSILGLPVKTTASGDSLMQESKPSTETFELNSSDAGRVLEVLNKELKIVTSKPSAPSKLVIVANFDLKAFNYRIMYQKLYDSSEVLDDRIELFSALTCRKYNISDEDLANPSELTQEPVVVVGRIVVESTNLGGRLNQNSILLESSRRLGAGVRVRLKVDDLPSYSIFPGQIVSVKGSNPSGNMFIAKEILPIPPLPFPSSSKQEHATFVANTNNQPISIYIASGPWSLRDDLSFSPLKSMISYVNKNPVDLVILCGPFLDINHILIRTGNITGTSATSLEELFKERVTPILSQLTCPCILIPHINDAASDHPAWPQDAFNRVALGLPSNFKCFPNPCMFSINDVVFGVSTNDILLHTSREELFRLPSHGNLFARLVSHVLHQRHFYPLFPGGSLEKCNPSNLDIAHLKLGEFLNTMPDILILPSDLRYFVKNVENVVSLNPGKATKGINLGTFAKLTIAPLELGDNGSSNHYSHRVWLRTKAEILKL pri2_schpo DNA primase large subunit pri2 spp2 SPBC17D11.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFRTTKSRVVEKNQNFSSASFESLSYPTRLNFYKKPPVSEISIEEFETWAIDRLVVLGEIESAMLRNKTKNELNGIIKKILDKRLPMSSNMARTVKGNSLDEERRKDHYSHFILRLAFSRSDELRIRFLRAESTLFRFRFVNEETRERQAFIDSLDFQWESVSQEEKDVFYEKLQASSQRNIENESFFKVPFFKVPDLVERRAVFVHKGYAYVPFSEQVSLVVEEFEENLKKALESTAKSLPRLDEDDRLLPILNHLSKGFVAPESSIVAPKSGAITAGQVDSFVSHFPLCAKHLHEVLKRDKHLRHFGRLQYGLFLKDIGLSVDEALVFWRKSFTNVTEDKFNKEYRYNIRHTYGLEGNRKNYKGYNCQQILTGPQLGPGDAHGCPYRTYSVNNLVSALASMGIAPDSAGCREVVEAVKARHYHIACTRVFELTHPNVGSLEESIHHPLQYFQLSLES pri1_schpo DNA primase small subunit pri1 spp1 SPAC6B12.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTVQIDELDDKDLDEIIANGTLDGAKQGAVDSETMIQYYRHLFPWKYLFQWLNHGPVVTNDFAHREFAFTLPNDAYIRYLSFSNWEELKKEALNLCPSRFEVGPVYSANPRDRKTIRKSTFHPLKKELVFDIDMTDYDDVRTCCSKTNICEKCWPFITIAVQVLDICFHEDFGFKHILWVYSGRRGIHAWICDEIACSLDDRSRRMIASYLQVVVGNPQGGVRLINNLKRPLHPHLTRSLNILKSAFVKIVLEDQDPWASKEGAENLLKLLPDKDLASALRKKWEVDPERSSKNKWSDIDTVLASGSIASISPSVIAIAKQDIVLTYLYPRLDVEVSRHLNHLLKSPFCVHPGTSRVCVPIDIERMDSFNPLKVPTVNDLLQELDKNSQNDNGHGPTMETNTTENQKDNARGQSNKGHGFSTSLNPYTLYFKSFSSQLFKETVGNKRKHENLEF mdm10_schpo Mitochondrial distribution and morphology protein 10 mdm10 SPAC17H9.17c Mitochondrial inheritance component mdm10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MMSFNDYIFYEYLKKTNWNIHNLYCNLTQTADNILNFEIPSGVSCQLSSLTSSNFASGCKISAMPILNGSMSYVYTNVNLENLNRNITYNLQHFYEGYKHVDVPFVHYVNEFQDKKLPLRPTLLYGRMHLPSQHLDAIFATRLSPWLLFFIQGVNEIEDGVGDNLCFNWQYDTGKRCLEFVYESSGAMLGVRGLWNLNYRELNTKINMENKAPSNMRWSLGFETYYGVLTKCAGASLGMRLHSGPSHPYAPFILTCTLNPIVGHITSTFSTAEPRTKAFSAQYDFNIYSYESQLKLGIELWRSKQEMSQSTNDPTANSMSSLLKGTCSTSGDVSISWQARIRNFLLTIGTEAQLTKIDPLFFGVHFEYSK pol1-pol12-1 Interaction of pol1and pol12 detected by pulldown 328612 N/A 328615 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328616 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false pri1-pri2-1 Interaction of pri1 and pri2 detected by pulldown 328612 N/A 328617 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328618 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false pol1-pri1-2 Interaction of mdm10, pol1, pol12, pri1 and pri2 detected by pulldown 328612 N/A 328619 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 328618 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328617 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328615 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328616 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection association association false false false pol1-mdm10-1 Interaction of mdm10 and pol1 detected by coimmunoprecipitation 328613 N/A 328615 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328619 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) physical association physical association false false false pol1-mdm10-2 Interaction of mdm10 and pol1 detected by pulldown 328613 N/A 328615 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328619 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association false false false pol1-pri1-1 Interaction of pol1, pol12, pri1 and pri2 detected by gycerol gradient centrifugation 328614 N/A 328617 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328615 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328618 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 328616 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false