IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ akamatsu-2003-2 Two different Swi5-containing protein complexes are involved in mating-type switching and recombination repair in fission yeast. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Akamatsu Y., Dziadkowiec D., Ikeguchi M., Shinagawa H., Iwasaki H. Two-hybrid interactions were judged by spot tests on three types of plates: high-stringency condition, medium-stringency condition and the control. 3a, 3c, 4b iwasaki@tsurumi.yokohamacu.ac.jp S. pombe cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 akamatsu-2003-3 Two different Swi5-containing protein complexes are involved in mating-type switching and recombination repair in fission yeast. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Akamatsu Y., Dziadkowiec D., Ikeguchi M., Shinagawa H., Iwasaki H. 3b, 4c iwasaki@tsurumi.yokohamacu.ac.jp S. pombe cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 akamatsu-2003-5 Two different Swi5-containing protein complexes are involved in mating-type switching and recombination repair in fission yeast. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Akamatsu Y., Dziadkowiec D., Ikeguchi M., Shinagawa H., Iwasaki H. 4d iwasaki@tsurumi.yokohamacu.ac.jp S. pombe cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 akamatsu-2003-1 Two different Swi5-containing protein complexes are involved in mating-type switching and recombination repair in fission yeast. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akamatsu Y., Dziadkowiec D., Ikeguchi M., Shinagawa H., Iwasaki H. iwasaki@tsurumi.yokohamacu.ac.jp S. pombe cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 akamatsu-2003-4 Two different Swi5-containing protein complexes are involved in mating-type switching and recombination repair in fission yeast. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Akamatsu Y., Dziadkowiec D., Ikeguchi M., Shinagawa H., Iwasaki H. 4c iwasaki@tsurumi.yokohamacu.ac.jp S. pombe cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2003 swi5_schpo Mating-type switching protein swi5 swi5 SPBC409.03 DNA repair protein swi5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVNGSE DAA84500D8A84B71 swi2_schpo Mating-type switching protein swi2 swi2 SPAC1142.03c SPAC17G6.20c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNVNKKQESIPVNTGSESISSNDNERFEQGKGVGSNLGSHFFEPVEYYYSDGKPMNQTEASQMKGTFSRDFSLNEMNNEFITDSFFCTTTPDPKTESPSFVKYNAHCDDHPEISGHVSSNDKDFAYFEDKSENQPLVTLPNENNQVIEPLSSQSCKSQLSTQNYSESDFGWNQLCDLDPIFKSLAFTDDTNLFPAFADSEAALIMLKKREMTRVKHRAGRPRKYSYVNKDLNFEEGLPRRRGRPTGWRKYPEKEEIYPTLSPRIKKPRKVFDAVVIPVTIKPSIYTEPSLPHHIDWNNGCSEEFDFEPSREDEDFPDLTSDSTGQDPLSSEPTIFDISPLPSDMEPTFSENSLITINKMAIEERKQSRRLEQPLAESQHQEDLLNPYGVDQDFDETCINESEQQATHIPNSSIKFNYDYTPPKSATSHKHKRVDLLASRKENVWTGLYGKVQTEMVSNRGEAVLNENNSKNRTNVTKPNSYKNSVLSIGNNHSNHSNIIKPNTYKNTILSNENNTPNYSNVCLSTSLINRSLPSLKSTMHPGVNKDLITRPFKNVNKMSVRKALIKPFHPPISKISRTRLTVSSPERLYCAKPISMATAPSETDSKLINRIRNLELEIGGLKEQLSVVELALDTDKNSKQIQVVERKIQNWRKSAQLAVEVLFPVFSLKFTTMLQEVPQSVLRTSANDLRTKPCSIGTYLEQLQIPFHLLQYNSETESWDLE swi6_schpo Chromatin-associated protein swi6 swi6 SPAC664.01c SPAC824.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE F505CC8AC5E75EAB rad51_schpo DNA repair protein rhp51 rhp51 rad51 SPAC644.14c RAD51 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MADTEVEMQVSAADTNNNENGQAQSNYEYDVNVQDEEDEAAAGPMPLQMLEGNGITASDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKADKLLGEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAYARAYNADHQLELLQQAANMMSESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRLADEFGIAVVITNQVVAQVDGISFNPDPKKPIGGNILAHSSTTRLSLRKGRGEQRICKIYDSPCLPESEAIFAINSDGVGDPKEIIAPV 9F26EB9FA4F3C2BA sfr1_schpo Swi5-dependent recombination DNA repair protein 1 sfr1 dds20 SPBC28F2.07 DNA repair protein dds20 Meiotically up-regulated gene 13 protein mug13 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQTINSELNENATSQCKEDLKVSLSESDLRDSQGQLGIENPPKCNNSGNHSDNLGFIEQSETVHPENEKALTPDLRDTKIHTSLPITTPFSKKRAREAKNILLKPFKSPLRQTASPQVADTNLKPSLAVTNLNSDETNTSSEPVTSPLRTTPNSIKRQKRLFKSPISNCLNPKSDPEITQLLSRRLKLEKEVRNLQEQLITAETARKVEAKNEDKDLQTLIQKWKNAAQQAAEVLFKPMAERIRLAGGVTQSFRIEEGENKGQIQEVRTEFTMSMFLNQFGVPVHLMSFDEENGDWKS EFE91ABDE965C82D swi5-swi2-1 364580 N/A 364585 unspecified role unspecified role bait bait N/A 364586 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction. Strong interaction. swi6-swi2 364580 N/A 364586 unspecified role unspecified role prey prey N/A 364587 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction. Strong interaction. rhp51-swi2 364580 N/A 364588 unspecified role unspecified role bait bait N/A 364586 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Medium interaction. Medium interaction. rhp51-rhp51 364580 N/A 364588 unspecified role unspecified role prey prey N/A 364588 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction. Strong interaction. swi5-swi5 364580 N/A 364585 unspecified role unspecified role bait bait N/A 364585 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Medium interaction. Medium interaction. swi6-swi6 364580 N/A 364587 unspecified role unspecified role prey prey N/A 364587 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Weak interaction. Weak interaction. swi5-swi2-3 364580 N/A 364586 unspecified role unspecified role bait bait c terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 364585 unspecified role unspecified role prey prey physical association physical association false false false Full length Q10668 interacted with Q9UUB7 in Figure 3C, while it did not in Figure 3A. rhp51-swi2-2 364580 N/A 364586 unspecified role unspecified role bait bait c terminus required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 364588 unspecified role unspecified role prey prey physical association physical association false false false Full length Q10668 interacted with P36601 in Figure 3C, while it did not in Figure 3A. swi6-swi2-1 364580 N/A 364587 unspecified role unspecified role prey prey N/A 364586 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Full length Q10668 interacted with p40381 in Figure 3C, while it did not in Figure 3A. swi5-sfr1 364580 N/A 364585 unspecified role unspecified role prey prey N/A 364589 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Medium interaction. Medium interaction. rhp51-sfr1 364580 N/A 364589 unspecified role unspecified role bait bait N/A 364588 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Medium interaction. Medium interaction. sfr1-sfr1 364580 N/A 364589 unspecified role unspecified role bait bait N/A 364589 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. Strong interaction. Strong interaction. swi5-swi2-2 364581 N/A 364586 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364585 unspecified role unspecified role bait bait physical association physical association false false false Q10668 overexpressed. rhp51-swi2-1 364581 N/A 364588 unspecified role unspecified role bait bait N/A 364586 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Q10668 overexpressed. swi5-sfr1-1 364581 N/A 364589 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364585 unspecified role unspecified role bait bait physical association physical association false false false Q9USV1 overexpressed. swi5-sfr1-3 364582 N/A 364589 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 364585 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false rhp51-sfr1-1 364582 N/A 364588 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 364589 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false swi5-swi2 364583 N/A 364585 unspecified role unspecified role bait bait N/A 364586 unspecified role unspecified role prey prey c terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false swi5-sfr1-2 364584 N/A 364585 unspecified role unspecified role prey prey N/A 364589 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Q9USV1 overexpressed.