IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-2003a-1 BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Xu L., Yang L., Moitra PK., Hashimoto K., Rallabhandi P., Kaul S., Meroni G., Jensen JP., Weissman AM., D'Arpa P. pdarpa@usuhs.mil Exp. Cell Res. (0014-4827) 2003 Only protein-protein interactions imex curation xu-2003a-2 BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Xu L., Yang L., Moitra PK., Hashimoto K., Rallabhandi P., Kaul S., Meroni G., Jensen JP., Weissman AM., D'Arpa P. pdarpa@usuhs.mil Exp. Cell Res. (0014-4827) 2003 Only protein-protein interactions imex curation btbd2_human BTB/POZ domain-containing protein 2 BTBD2 protein protein human Homo sapiens Human MAAGGSGGRASCPPGVGVGPGTGGSPGPSANAAATPAPGNAAAAAAAAAAAAAAPGPTPPAPPGPGTDAQAAGAERAEEAAGPGAAALQREAAYNWQASKPTVQERFAFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTEIELPDVEPAAFLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLLTQARLFDEPQLASLCLENIDKNTADAITAEGFTDIDLDTLVAVLERDTLGIREVRLFNAVVRWSEAECQRQQLQVTPENRRKVLGKALGLIRFPLMTIEEFAAGPAQSGILVDREVVSLFLHFTVNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNKRIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT btbd1_human BTB/POZ domain-containing protein 1 BTBD1 C15orf1 Hepatitis C virus NS5A-transactivated protein 8 NS5ATP8 protein protein human Homo sapiens Human MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEFAAGPAQSGILSDREVVNLFLHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDRIRFTVNRRISIVGFGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT q9c035-4 Tripartite motif-containing protein 5 TRIM5 RNF88 RING finger protein 88 RING-type E3 ubiquitin transferase TRIM5 protein protein human Homo sapiens Human MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWGWSAMARSRFTATSTSQIQAILLPQPPK ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM btbd1-btbd2-1 Colocalisation of BTBD1 and BTBD2 to cytoplasmic bodies 371041 N/A 371043 unspecified role unspecified role neutral component neutral component n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 371044 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Q9H0C5 transfection; 3c btbd1-btbd2-2 Colocalisation of BTBD1 and BTBD2 to cytoplasmic bodies 371041 N/A 371044 unspecified role unspecified role neutral component neutral component n-terminus dsred-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 371043 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Q9BX70 transfection; 3i btbd2-trim5-1 Colocalisation of Trim5delta and BTBD2 to cytoplasmic bodies 371041 N/A 371043 unspecified role unspecified role neutral component neutral component N/A 371045 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9C035-4:p.[Cys15Ala;Cys18Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false colocalization colocalization false false false Q9H0C5 transfection; 4c, 4f, 4i btbd1-btbd2-3 Colocalisation of BTBD1 and BTBD2 to cytoplasmic bodies 371041 N/A 371043 unspecified role unspecified role neutral component neutral component n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false btb region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 371044 unspecified role unspecified role neutral component neutral component n-terminus ds-red tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Q9H0C5 transfection; Q9BX70 transfection; 5 btbd2-btbd2-1 Colocalisation of BTBD1 and BTBD2 to cytoplasmic bodies 371041 N/A 371043 unspecified role unspecified role neutral component neutral component n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 371043 unspecified role unspecified role neutral component neutral component n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false btb region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Q9BX70 transfection; 5 btbd2-trim5-2 Colocalisation of Trim5delta and BTBD2 to cytoplasmic bodies 371041 N/A 371045 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 371043 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Q9BX70 transfection; Q9C035-4 transfection; 5 trim5-6 Autoubiquitinylation of Trim5delta 371042 N/A 371045 self self unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9C035-4:p.[Cys15Ala;Cys18Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 371046 unspecified role unspecified role ancillary ancillary ubiquitination ubiquitination reaction ubiquitination false false false 6 Presence of UBE2D2 required for ubiquitinylation