UniProt UniProt http://www.uniprot.org pidoux-2003-1 Sim4: a novel fission yeast kinetochore protein required for centromeric silencing and chromosome segregation. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Pidoux AL., Richardson W., Allshire RC. robin.allshire@ed.ac.uk J. Cell Biol. (0021-9525) 2003 pidoux-2003-2 Sim4: a novel fission yeast kinetochore protein required for centromeric silencing and chromosome segregation. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pidoux AL., Richardson W., Allshire RC. robin.allshire@ed.ac.uk J. Cell Biol. (0021-9525) 2003 pidoux-2003-3 Sim4: a novel fission yeast kinetochore protein required for centromeric silencing and chromosome segregation. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pidoux AL., Richardson W., Allshire RC. robin.allshire@ed.ac.uk J. Cell Biol. (0021-9525) 2003 cenpi_schpo Inner kinetochore subunit mis6 Sim4 complex subunit mis6 mis6 SPAC1687.20c CENP-I homolog Constitutive centromere-associated network protein mis6 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MESFENKGFLDIEEGIQWIKKNSENLSSSKKTILARLQQFHKLCSEVGLNQHSISSLLDVILSKKTHFDKNHVQLLIKCLYPNELISQTIAIRIISSLDPHGLRCSYAIQAKLLNWLIHVYEFLDGNNLLCRYYGVLFHFLDFLTLRPYISNLLVLLTKHYHVKSFRIHQLLALYQKPGNTADPYLLALILTYKQHFPDVIVGSYTYRKHGSVRLDSEWIAATKAILNRQSEDVPLETWSSEKRKRQSSLIPDLITMKNTSSSYSLEELTSVQQMGLVYEKIVFPSRIAAVLKSKLFLIFLFLKNKNVYYSRLDEWLHITLNYGLALRSGSNNQEEEVLHLLYKYLLFSPKFPKSLLQYVITFFSKPNITEENYNLLTLLVTHIPITTDSSYFNSLLKEFEQFILQKNAEFCSKHLNILWLWLFRMLNLRIASMGNNHTLLEKCLLITNHATFLVSHFSWDVSLAYQLSRLFQLYYKILTKIRKQIEPNIPPKELIYVLFFQPSAFYINSMVGLLLLTKNYQERLMDSRIDAISKFTHSYLKSLSEIILLKEKRAILSFLQLWEPFKSDYSQFLPIATRIANDHPYAQRVFSLTCAPQFFSYINGYQIYLQQTNPATGSIPLKPIQEETFGAFQSNLHLSDSWEDFQKNFIIYLKKKGYLAISDFLLSTLNR cenpk_schpo Inner kinetochore subunit sim4 Silencing in the middle of the centromere protein 4 sim4 SPBC18E5.03c CENP-K homolog Constitutive centromere-associated network protein sim4 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNSENASLFRNILNDTENLVQPLTQDESRLALFESLVQSDQLLVEKIEKWEKKVSKFTENSKSEKRKLQLELFQEIIDLKKCIAFKPIIGKNAIDNNISDLKKNLHSNKKLEAVLKEELHQIKKFSSDLQSLKSSMGERQKQQAAMSRRGKKSIIHSAIIQEKERYEKESQELFTFLDGFLDEHAPSLLEGAQASIDKNRPGKNQPSLNFENISKKDLTEEFKQVIENLMNNSIIPGSPYIEVKNERIVSFLVLASLCTVDPQDPSKVKLIPFSDEI sim4-mis6-1 564916 N/A 564919 unspecified role unspecified role neutral component neutral component c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 564920 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 4B sim4-mis6-2 564916 N/A 564920 unspecified role unspecified role neutral component neutral component N/A 564919 unspecified role unspecified role neutral component neutral component c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 4C mis6-sim4-1 564917 N/A 564920 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 564919 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 6A sim4-mis6-3 564917 N/A 564920 unspecified role unspecified role bait bait c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 564919 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 6A sim4-mis6-4 564918 N/A 564919 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 564920 unspecified role unspecified role bait bait c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 6A