UniProt UniProt http://www.uniprot.org chattopadhy-2003-1 The yeast model for Batten disease: a role for Btn2p in the trafficking of the Golgi-associated vesicular targeting protein, Yif1p. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid partial dna sequence hybrid partial dna sequence identification by hybridization partial dna sequence hybrid Chattopadhyay S., Roberts PM., Pearce DA. The experiment used the Cytotrap(stratagene) two-hybrid system based on human SOS-fusion for the bait and a cDNA library fused to a myristoylation signal to identify the preys. subrata_chattopadhyay@urmc.rochester.edu Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation chattopadhy-2003-2 The yeast model for Batten disease: a role for Btn2p in the trafficking of the Golgi-associated vesicular targeting protein, Yif1p. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chattopadhyay S., Roberts PM., Pearce DA. The experiment used the Cytotrap(stratagene) two-hybrid system based on human SOS-fusion for the bait and a cDNA library fused to a myristoylation signal to identify the preys. subrata_chattopadhyay@urmc.rochester.edu Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation btn2_yeast Protein BTN2 YGR142W BTN2 Batten disease protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSIFNSPCVFEQLPSFSQPLHSRYFDCSSPVSYYPECKRRKAIKANLRAPKKSDANCSEPLRYALAETPNGYTLSLSKRIPYELFSKYVNEKLGELKENHYRPTYHVVQDFFGNQYYVEDEADEDALLRSALKDLDFRAIGKKIAKDLFQDYEIELNHRGDELSILSKKDKIFKEFSLDQVFEDVFVIGCGVENIDDGSREKYALLKIGLVKHEEEISEGGINEPKMPIIESKIDESHDDVNMSESLKEEEAEKAKEPLTKEDQIKKWIEEERLMQEESRKSEQEKAAKEDEERQKKEKEARLKARKESLINKQKTKRSQQKKLQNSKSLPISEIEASNKNNNSNSGSAESDNESINSDSDTTLDFSVSGNTLKKHASPLLEDVEDEEVDRYNESLSRSPKGNSIIEEI E7AE1EB1E3612F3E yif1_yeast Protein transport protein YIF1 YNL263C N0820 YIF1 YIP1-interacting factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYNPYAYATSEQNGVNDRFSHTPQQQRPMQIPRNTPVNGQGNANMNANVNGSGGGFPFQDPRGSMAFQLGQSAFSNFIGQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLKLILVPFLNGTKNWQRIMDSGNFLPPRDDVNSPDMYMPIMGLVTYILIWNTQQGLKGSFNPEDLYYKLSSTLAFVCLDLLILKLGLYLLIDSKIPSFSLVELLCYVGYKFVPLILAQLLTNVTMPFNLNILIKFYLFIAFGVFLLRSVKFNLLSRSGAEDDDIHVSISKSTVKKCNYFLFVYGFIWQNVLMWLMG btn2-yif1 Interaction detected by Y2H 499489 N/A 499491 unspecified role unspecified role bait bait N/A 499492 unspecified role unspecified role prey prey physical association physical association false false false 1A btn2-yif1-1 Interaction detected by CoIP 499490 N/A 499491 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 499492 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1B