IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pioli-2002-1 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation pioli-2002-2 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. mouse-dp28-9 Mus musculus dp28-9 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-3 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. mouse-cb3 Mus musculus erythroleukemia cell line CB3 cb3 erythroleukemia cell line CB3 density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-4 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. mouse-cb3 Mus musculus erythroleukemia cell line CB3 cb3 erythroleukemia cell line CB3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-5 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-6 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-7 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-8 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. pioli-2002-9 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. mouse-cb3 Mus musculus erythroleukemia cell line CB3 cb3 erythroleukemia cell line CB3 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation pioli-2002-10 Lactate dehydrogenase is an AU-rich element-binding protein that directly interacts with AUF1. in vitro In vitro crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Pioli PA., Hamilton BJ., Connolly JE., Brewer G., Rigby WF. CB3 polysomes (0.5 A260) and 1 M poly(U)-purified eluate (50 micro g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. william.rigby@dartmouth.edu. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation CB3 polysomes (0.5 A260) and 1 M poly(U)- purified eluate (50g) were UV cross-linked to [32P]UTP-labeled wild type GM-CSF RNA, RNase-digested, and then analyzed by two-dimensional NEPHGE and autoradiography. ldha_mouse L-lactate dehydrogenase A chain LDH muscle subunit Ldha Ldh-1 Ldh1 protein protein mouse Mus musculus Mouse MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF gm-csf RNA rna ribonucleic acid RNA rna human Homo sapiens Human Sequence:ACACAGAGAGAAAGGCTAAAGTTCTCTGGAGGATGTGGCTGCAGAGCCTGCTGCTCTTGG GCACTGTGGCCTGCAGCATCTCTGCACCCGCCCGCTCGCCCAGCCCCAGCACGCAGCCCT GGGAGCATGTGAATGCCATCCAGGAGGCCCGGCGTCTCCTGAACCTGAGTAGAGACACTG CTGCTGAGATGAATGAAACAGTAGAAGTCATCTCAGAAATGTTTGACCTCCAGGAGCCGA CCTGCCTACAGACCCGCCTGGAGCTGTACAAGCAGGGCCTGCGGGGCAGCCTCACCAAGC TCAAGGGCCCCTTGACCATGATGGCCAGCCACTACAAGCAGCACTGCCCTCCAACCCCGG AAACTTCCTGTGCAACCCAGATTATCACCTTTGAAAGTTTCAAAGAGAACCTGAAGGACT TTCTGCTTGTCATCCCCTTTGACTGCTGGGAGCCAGTCCAGGAGTGAGACCGGCCAGATG AGGCTGGCCAAGCCGGGGAGCTGCTCTCTCATGAAACAAGAGCTAGAAACTCAGGATGGT CATCTTGGAGGGACCAAGGGGTGGGCCACAGCCATGGTGGGAGTGGCCTGGACCTGCCCT GGGCCACACTGACCCTGATACAGGCATGGCAGAAGAATGGGAATATTTTATACTGACAGA AATCAGTAATATTTATATATTTATATTTTTAAAATATTTATTTATTTATTTATTTAAGTT CATATTCCATATTTATTCAAGATGTTTTACCGTAATAATTATTATTAAAAATATGCTTCT A roa1_mouse Heterogeneous nuclear ribonucleoprotein A1 Hnrpa1 hnRNP core protein A1 Helix-destabilizing protein HDP-1 Single-strand-binding protein Topoisomerase-inhibitor suppressed Hnrnpa1 Fli-2 Tis protein protein mouse Mus musculus Mouse MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF hnrpd_mouse Heterogeneous nuclear ribonucleoprotein D0 Hnrnpd Auf1 Hnrpd AU-rich element RNA-binding protein 1 protein protein mouse Mus musculus Mouse MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKIDASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY hnrpd_human Heterogeneous nuclear ribonucleoprotein D0 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY ldh6b_human L-lactate dehydrogenase A-like 6B LDHAL6B LDHAL6 LDHL protein protein human Homo sapiens Human MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIERFTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPFTKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHCKLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILGEHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPEEEAHLKKSAKTLWEIQNKLKL ldha_rabit L-lactate dehydrogenase A chain LDHA LDH muscle subunit protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MAALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF q60668-3 Heterogeneous nuclear ribonucleoprotein D0 muAUF1-3 Hnrnpd Auf1 Hnrpd AU-rich element RNA-binding protein 1 protein protein mouse Mus musculus Mouse MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKIDASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 280. Contains a omega-N-methylarginine at position 282. ldha-hnrpa1 515291 N/A 515301 unspecified role unspecified role neutral component neutral component mouse-cb7 Mus musculus cb7 cell cb7 N/A 515302 unspecified role unspecified role neutral component neutral component auuua mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 515303 unspecified role unspecified role neutral component neutral component mouse-cb7 Mus musculus cb7 cell cb7 physical association physical association false false false 1B,C ldha-hnrpa1-1 515292 N/A 515303 unspecified role unspecified role neutral component neutral component mouse-dp28-9 Mus musculus dp28-9 N/A 515301 unspecified role unspecified role neutral component neutral component mouse-dp28-9 Mus musculus dp28-9 N/A 515302 unspecified role unspecified role neutral component neutral component region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false auuua mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 1B,C ldha-hnrpd 515293 N/A 515301 unspecified role unspecified role neutral component neutral component N/A 515304 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig.6 hnrpd-ldha-1 515294 N/A 515301 unspecified role unspecified role prey prey N/A 515304 unspecified role unspecified role bait bait physical association physical association false false false Fig.7A hnrpd-ldha-3 515295 N/A 515305 unspecified role unspecified role prey prey N/A 515306 unspecified role unspecified role bait bait physical association physical association false false false Fig.7B hsp70 is also coimmunoprecipitated with AUF1. Hsp 70 can not be assigned a Swissprot AC. ldha-hnrpd-1 515296 N/A 515306 unspecified role unspecified role neutral component neutral component N/A 515305 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig.6 hnrpd-ldha-4 515297 N/A 515307 unspecified role unspecified role prey prey N/A 515308 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig.7C ldha-hnrpa1-2 515298 N/A 515302 unspecified role unspecified role neutral component neutral component auuua mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 515301 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction false false false Fig 3 ldha-csf 515299 N/A 515302 unspecified role unspecified role neutral component neutral component region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 515301 unspecified role unspecified role neutral component neutral component mouse-cb7 Mus musculus cb7 cell cb7 physical association physical association false false false 2D ldha-csf-1 515300 N/A 515302 unspecified role unspecified role neutral component neutral component region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 515301 unspecified role unspecified role neutral component neutral component mouse-cb7 Mus musculus cb7 cell cb7 physical association physical association false false false 2C