IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pan-2001-1 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pan H., Qin WX., Huo KK., Wan DF., Yu Y., Xu ZG., Hu QD., Gu KT., Zhou XM., Jiang HQ., Zhang PP., Huang Y., Li YY., Gu JR. Cancer - Interactions investigated in the context of cancer nlorg@public.sta.net.cn Two cDNA libraries were used, one derived from human fetal brain and one from human liver (OriGene). Genomics (0888-7543) 2001 Only protein-protein interactions imex curation pan-2001-2 Cloning, mapping, and characterization of a human homologue of the yeast longevity assurance gene LAG1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pan H., Qin WX., Huo KK., Wan DF., Yu Y., Xu ZG., Hu QD., Gu KT., Zhou XM., Jiang HQ., Zhang PP., Huang Y., Li YY., Gu JR. Cancer - Interactions investigated in the context of cancer nlorg@public.sta.net.cn Two cDNA libraries were used, one derived from human fetal brain and one from human liver (OriGene). Genomics (0888-7543) 2001 Only protein-protein interactions imex curation asgr1_human Asialoglycoprotein receptor 1 ASGR1 Hepatic lectin H1 CLEC4H1 C-type lectin domain family 4 member H1 protein protein human Homo sapiens Human MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL cers2_human Ceramide synthase 2 CERS2 TMSG1 Tumor metastasis-suppressor gene 1 protein SP260 LASS2 LAG1 longevity assurance homolog 2 Sphingosine N-acyltransferase CERS2 Very-long-chain ceramide synthase CERS2 protein protein human Homo sapiens Human MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKND asgr2_human Asialoglycoprotein receptor 2 ASGR2 Hepatic lectin H2 CLEC4H2 C-type lectin domain family 4 member H2 protein protein human Homo sapiens Human MAKDFQDIQQLSSEENDHPFHQGEGPGTRRLNPRRGNPFLKGPPPAQPLAQRLCSMVCFSLLALSFNILLLVVICVTGSQSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRRNATGEVA s22a1_human Solute carrier family 22 member 1 SLC22A1 OCT1 Organic cation transporter 1 protein protein human Homo sapiens Human MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT vatl_human V-type proton ATPase 16 kDa proteolipid subunit ATP6V0C ATP6C ATP6L ATPL Vacuolar proton pump 16 kDa proteolipid subunit protein protein human Homo sapiens Human MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK lass2-asgr1 A yeast two hybrid assay indicates LASS2 interacts with AGPRH1 571358 N/A 571360 unspecified role unspecified role prey prey N/A 571361 unspecified role unspecified role bait bait physical association physical association false false false The UniprotKB sequence P07306 for the asialoglycoprotein receptor type 1 does not have the initial Met found in the sequence referred to by the authors (GenBank M10058). lass2-asgr2 A yeast two hybrid assay indicates LASS2 interacts with AGPRH2 571358 N/A 571362 unspecified role unspecified role prey prey N/A 571361 unspecified role unspecified role bait bait physical association physical association false false false lass2-hoct1 A yeast two hybrid assay indicates LASS2 interacts with hOCT1 571358 N/A 571363 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false N/A 571361 unspecified role unspecified role bait bait physical association physical association false false false The authors state that the 5' ends of the cDNAs for OCT1 began at +917 and +973. Thus the shortest construct begins at amino acid 325. However, they do not specify where the 3' end finishes. lass2-atp6v0c A yeast two hybrid assay indicates LASS2 interacts with VPL 571358 N/A 571364 unspecified role unspecified role prey prey N/A 571361 unspecified role unspecified role bait bait physical association physical association false false false asgr1-lass2 GST-AGPRH1 pulls down LASS2 571359 N/A 571360 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 571361 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false The UniprotKB sequence P07306 for the asialoglycoprotein receptor type 1 does not have the initial Met found in the sequence referred to by the authors (GenBank M10058). 4 asgr2-lass2 GST-AGPRH2 pulls down LASS2 571359 N/A 571362 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 571361 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 4 hoct1-lass2 GST-hOCT1 pulls down LASS2 571359 N/A 571361 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 571363 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 4 It is specified that the hOCT1 construct begins at residue 306 and is the C-terminal half of the protein. However, the authors state that the construct ends at residue 544 and also that it ends at 504. The translation of the GenBank sequence they refer to (U77086)is 554 residues long as the UniprotKB sequence. hoct1-lass2-1 GST-VPL pulls down LASS2 571359 N/A 571364 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 571361 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 4