UniProt UniProt http://www.uniprot.org naiki-2001-1 Chl12 (Ctf18) forms a novel replication factor C-related complex and functions redundantly with Rad24 in the DNA replication checkpoint pathway. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Naiki T., Kondo T., Nakada D., Matsumoto K., Sugimoto K. j46036a@nucc.cc.nagoya-u.ac.jp Mol. Cell. Biol. (0270-7306) 2001 Only protein-protein interactions imex curation ctf18_yeast Chromosome transmission fidelity protein 18 YMR078C YM9582.03C CTF18 CHL12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDTAPYIGSLGRSSLFDTGDIEQAPGNNAIGINEEDIHAFVSSTGETVQLKKKPAKLATGNISLYTNPDTVWRSDDTYGININYLLDKIEASGDDRTNAQKTSPITGKIGSDTLWVEKWRPKKFLDLVGNEKTNRRMLGWLRQWTPAVFKEQLPKLPTEKEVSDMELDPLKRPPKKILLLHGPPGIGKTSVAHVIAKQSGFSVSEINASDERAGPMVKEKIYNLLFNHTFDTNPVCLVADEIDGSIESGFIRILVDIMQSDIKATNKLLYGQPDKKDKKRKKKRSKLLTRPIICICNNLYAPSLEKLKPFCEIIAVKRPSDTTLLERLNLICHKENMNIPIKAINDLIDLAQGDVRNCINNLQFLASNVDSRDSSASDKPACAKNTWASSNKDSPISWFKIVNQLFRKDPHRDIKEQFYELLNQVELNGNSDRILQGCFNIFPYVKYSDNGIRKPANISDWLFFHDLMYQSMYAHNGELLRYSALVPLVFFQTFGDIANKDDIRMKNSEYEQRELKRANSDIVSLIMRHISVQSPLMASFTDRKSLIFEILPYLDSMISSDFNKIRNLKLKQAIMEELVQLLKSFQLNLIQNRSEGFDVRGGLTIDPPIDEVVLLNPKHINEVQHKRANNLSSLLAKIEENRAKKRHIDQVTEDRLQSQEMHSKKVKTGLNSSSSTIDFFKNQYGLLKQTQELEETQKTIGSDETNQADDCNQTVKIWVKYNEGFSNAVRKNVTWNNLWE rfc2_yeast Replication factor C subunit 2 RFC2 YJR068W J1808 Activator 1 41 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MFEGFGPNKKRKISKLAAEQSLAQQPWVEKYRPKNLDEVTAQDHAVTVLKKTLKSANLPHMLFYGPPGTGKTSTILALTKELYGPDLMKSRILELNASDERGISIVREKVKNFARLTVSKPSKHDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYSGVTRFCLICNYVTRIIDPLASRCSKFRFKALDASNAIDRLRFISEQENVKCDDGVLERILDISAGDLRRGITLLQSASKGAQYLGDGKNITSTQVEELAGVVPHDILIEIVEKVKSGDFDEIKKYVNTFMKSGWSAASVVNQLHEYYITNDNFDTNFKNQISWLLFTTDSRLNNGTNEHIQLLNLLVKISQL 59B2C4223B0D13BF rfc3_yeast Replication factor C subunit 3 RFC3 YNL290W N0533 Activator 1 40 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV 0170EDABAB5CEA52 rfc4_yeast Replication factor C subunit 4 RFC4 YOL094C O0923 Activator 1 37 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKTLSLQLPWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADGVLELNASDDRGIDVVRNQIKHFAQKKLHLPPGKHKIVILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHGLVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKGYSSIDIVTTSFRVTKNLAQVKESVRLEMIKEIGLTHMRILEGVGTYLQLASMLAKIHKLNNKA 1F55F35F0713331F rfc5_yeast Replication factor C subunit 5 RFC5 YBR087W YBR0810 Activator 1 40 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLWVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKKTRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAPIKSRCLLIRCPAPSDSEISTILSDVVTNERIQLETKDILKRIAQASNGNLRVSLLMLESMALNNELALKSSSPIIKPDWIIVIHKLTRKIVKERSVNSLIECRAVLYDLLAHCIPANIILKELTFSLLDVETLNTTNKSSIIEYSSVFDERLSLGNKAIFHLEGFIAKVMCCLD 4CD403AF2AFA2961 rfc2-ctf18-1 492908 N/A 492909 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492910 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A ctf18-rfc2-1 492908 N/A 492910 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492909 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6B rfc3-ctf18-1 492908 N/A 492909 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492911 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A ctf18-rfc3-1 492908 N/A 492909 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492911 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B rfc4-ctf18-1 492908 N/A 492909 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492912 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A ctf18-rfc4-1 492908 N/A 492909 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492912 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B rfc5-ctf18-1 492908 N/A 492909 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492913 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A ctf18-rfc5-1 492908 N/A 492909 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 492913 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B