IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ parris-2000-1 Crystal structures of substrate binding to Bacillus subtilis holo-(acyl carrier protein) synthase reveal a novel trimeric arrangement of molecules resulting in three active sites. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Parris KD., Lin L., Tam A., Mathew R., Hixon J., Stahl M., Fritz CC., Seehra J., Somers WS. PDBe - Data obtained from the Protein Data Bank Europe parrisk@war.wyeth.com Structure (0969-2126) 2000 acp_bacsu Acyl carrier protein acpA acpP BSU15920 protein protein bacsu Bacillus subtilis MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ acps_bacsu Holo-[acyl-carrier-protein] synthase acpS BSU04620 4'-phosphopantetheinyl transferase AcpS ydcB protein protein bacsu Bacillus subtilis MIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAAQVVIERLSS acpa-acps-1 Holo-(acyl carrier protein) synthase in complex with holo- (acyl carrier protein) 512166 N/A 512167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 N/A 512168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 direct interaction direct interaction false false false hexameric, multimeric working 77.800%, free 72.100% 2.3A