IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xia-1999-5 Clustering of AMPA receptors by the synaptic PDZ domain-containing protein PICK1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xia J., Zhang X., Staudinger J., Huganir RL. 1 rhuganir@jhmi.edu rat hippocampal cDNA library Neuron (0896-6273) 1999 Only protein-protein interactions imex curation xia-1999-1 Clustering of AMPA receptors by the synaptic PDZ domain-containing protein PICK1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Xia J., Zhang X., Staudinger J., Huganir RL. rhuganir@jhmi.edu rat hippocampal cDNA library Neuron (0896-6273) 1999 Only protein-protein interactions imex curation xia-1999-2 Clustering of AMPA receptors by the synaptic PDZ domain-containing protein PICK1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xia J., Zhang X., Staudinger J., Huganir RL. 2D rhuganir@jhmi.edu rat hippocampal cDNA library Neuron (0896-6273) 1999 Only protein-protein interactions imex curation xia-1999-3 Clustering of AMPA receptors by the synaptic PDZ domain-containing protein PICK1. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Xia J., Zhang X., Staudinger J., Huganir RL. 2E rhuganir@jhmi.edu rat hippocampal cDNA library Neuron (0896-6273) 1999 Only protein-protein interactions imex curation xia-1999-4 Clustering of AMPA receptors by the synaptic PDZ domain-containing protein PICK1. rat-brain Rattus norvegicus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Xia J., Zhang X., Staudinger J., Huganir RL. 3A rhuganir@jhmi.edu rat hippocampal cDNA library Neuron (0896-6273) 1999 Only protein-protein interactions imex curation pick1_rat PRKCA-binding protein Pick1 Prkcabp Protein kinase C-alpha-binding protein Protein interacting with C kinase 1 protein protein rat Rattus norvegicus (Rat) Rat MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGGFTDGEDEEEEEEDGAAREVSKDARGATGPTDKGGSWCDS gria2_rat Glutamate receptor 2 Gria2 Glur2 GluR-B GluR-K2 Glutamate receptor ionotropic, AMPA 2 AMPA-selective glutamate receptor 2 protein protein rat Rattus norvegicus (Rat) Rat MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI p19493-3 Glutamate receptor 4 Gria4 AMPA-selective glutamate receptor 4 GluR-D Glur4 Glutamate receptor ionotropic, AMPA 4 4C flop protein protein rat Rattus norvegicus (Rat) Rat MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKSAQTFNPTSSQNTHNLATYREGYNVYGTESIKI mint homomint gria3_rat Glutamate receptor 3 Gria3 Glur3 GluR-K3 Glutamate receptor ionotropic, AMPA 3 AMPA-selective glutamate receptor 3 GluR-C protein protein rat Rattus norvegicus (Rat) Rat MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLSYYKWEKFVYLYDTERGFSVLQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI pick1-pick1-1 PICK1 is capable of self-association, detected by yeast two hybrid. 370704 N/A 370709 unspecified role unspecified role prey prey N/A 370709 unspecified role unspecified role bait bait physical association physical association false false false gria2-pick1-4 PICK1 interacts with the intracellular C-terminal domains of GluR2 and GluR3 370704 N/A 370709 unspecified role unspecified role prey prey Q9EP80:p.Lys27_Asp28delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 370710 unspecified role unspecified role bait bait c-terminal region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false gria3-pick1-2 PICK1 interacts with the intracellular C-terminal domains of GluR2, GluR3 and GluR4c 370704 N/A 370711 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 370709 unspecified role unspecified role prey prey physical association physical association false false false The addition of a single extra tyrosine amino acid at the C-terminus of GluR3 (AA position 884) abolished the interaction with PICK1. gria3-pick1-1 370704 N/A 370712 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P19492:p.Ile888delinsIleTyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 370709 unspecified role unspecified role prey prey physical association physical association false false false The addition of a single extra tyrosine amino acid at the C-terminus of GluR3 (AA position 884) abolished the interaction with PICK1. pick1-gria2-1 Interaction of PICK1 with AMPA Receptors in the Yeast Two-Hybrid System. 370705 N/A 370710 unspecified role unspecified role bait bait c-terminal domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 370709 unspecified role unspecified role prey prey physical association physical association false false false pick1-gria3-1 Interaction of PICK1 with AMPA receptors in the yeast two-hybrid system. 370705 N/A 370709 unspecified role unspecified role prey prey N/A 370712 unspecified role unspecified role bait bait c-terminal domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The Gria3 protein has a length of 888 AA, however when a single amino acid is added to the C terminus of this protein no binding to PICK1 was observed. pick1-gria2-3 Association of PICK1 with AMPA Receptors In Situ and In Vivo. 370706 N/A 370709 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 370710 unspecified role unspecified role prey prey physical association physical association false false false Proteins were immunoprecipitated by an anti-PICK1 antibody 2 days after transfection. The immunoprecipitates were then resolved by SDS-PAGE and immunoblotted with affinity-purified anti-Glu2/3 antibody. pick1-gria2-5 Association of PICK1 with AMPA Receptors In Situ and In Vivo. 370707 N/A 370710 unspecified role unspecified role prey prey N/A 370712 unspecified role unspecified role prey prey N/A 370709 unspecified role unspecified role bait bait association association false false false Proteins were immunoprecipitated with an anti-PICK1 polyclonal antibody. The immunoprecipitates were then analysed with an affinity-purified anti-GluR2/3 antibody that recognises both GluR2 and GluR3. As the second antibody used was not able to distinguish between GluR2 and GluR3, the authors could not determine which protein the PICK1 coimmunoprecipitated with in this experiment. However previous experiments have shown that both these proteins bind PICK1 e.g. EBI-935346 and EBI-935341 pick1-gria2-6 PICK1 colocalises with AMPA Receptors at Excitatory synapses. 370708 N/A 370710 unspecified role unspecified role neutral component neutral component N/A 370709 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false PICK1 colocalises with AMPA Receptors at Excitatory synapses.