IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-1999-2 A bioluminescence resonance energy transfer (BRET) system: application to interacting circadian clock proteins. ecoli Escherichia coli (strain K12) bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Xu Y., Piston DW., Johnson CH. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species 2B carl.h.johnson@vanderbilt.edu Department of Biology, Box 1812-B, Vanderbilt University, Nashville, TN 37235 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 xu-1999-1 A bioluminescence resonance energy transfer (BRET) system: application to interacting circadian clock proteins. in vitro In vitro bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Xu Y., Piston DW., Johnson CH. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species carl.h.johnson@vanderbilt.edu Department of Biology, Box 1812-B, Vanderbilt University, Nashville, TN 37235 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 kaib_syne7 Circadian clock protein KaiB kaiB see0010 Synpcc7942_1217 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF kaia_syne7 Circadian clock protein KaiA see0009 kaiA Synpcc7942_1218 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET kaib-kaib-3 in vivo BRET interaction KaiB KaiB 201196 N/A 201198 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 201198 unspecified role unspecified role fluorescence donor fluorescence donor n terminal renilla luciferase fusion protein fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false kaib-kaia-9 in vivo BRET interaction KaiB-kaiA 201196 N/A 201199 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 201198 unspecified role unspecified role fluorescence donor fluorescence donor n terminal renilla luciferase fusion protein fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false kaib-kaib-1 in vitro BRET interaction 201197 N/A 201198 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 201198 unspecified role unspecified role fluorescence donor fluorescence donor n terminal renilla luciferase fusion protein fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false