IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ laherty-1998-2 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-3 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-4 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-1 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-5 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-6 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-7 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 laherty-1998-8 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email library of mouse embryo cDNA's used Mol. Cell (1097-2765) 1998 sap30_mouse Histone deacetylase complex subunit SAP30 30 kDa Sin3-associated polypeptide Sin3 corepressor complex subunit SAP30 Sap30 Sin3-associated polypeptide p30 protein protein mouse Mus musculus Mouse MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP rbbp4_mouse Histone-binding protein RBBP4 Rbbp4 Rbap48 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 protein protein mouse Mus musculus Mouse MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS sin3b_mouse Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b Sin3b Kiaa0700 protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIRQLLHRFLPSLFFSQQCPGTSDDSADERDRDRDSAEPERRRPTDEKPPADASPEPPKVLDDVYSLFFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRRGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVFLQRNLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHRHFEEWHGRWLEDNVTVAAAGLVQDWLMGEEEEDMVPCKTLCETAHVHGLPVTRYRVQYSRRPASP ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD sap30-sin3a-2 Co-ip of in-vivo interaction between sap30 and sin3a 184467 N/A 184475 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184476 unspecified role unspecified role prey prey physical association physical association false false false sap30-hdac1-1 Co-ip of in-vivo interaction between sap30 and hdac1 184467 N/A 184475 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184477 unspecified role unspecified role prey prey physical association physical association false false false sap30-hdac2-1 Co-ip of in-vivo interaction between sap30 and hdac2 184467 N/A 184478 unspecified role unspecified role prey prey N/A 184475 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sap30-rbap48-1 Co-ip of in-vivo interaction between sap30 and rbbp4 (rbap48) 184467 N/A 184479 unspecified role unspecified role prey prey N/A 184475 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sap30-sin3a-3 GST pulldown showing interaction between sap30 and sin3a 184468 N/A 184476 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 184475 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false sap30-sin3b-1 GST pulldown showing interaction between sap30 and sin3b 184468 N/A 184475 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 184480 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false sap30-ncor1-1 GST pulldown showing interaction between sap30 and ncor1 184468 N/A 184481 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 184475 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false A fragment of NCor1 (AA 1-393) encompassing repression domain was sufficient for binding to GST-Sap30. sap30-sin3a-4 GST pulldown to determine a domain on sap30 for interaction with sin3a 184469 N/A 184476 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 184475 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Demonstrates that interaction occurs with all three fragments (fl, 1-167 and 129-220) of Sap30 and Sin3a. sap30-ncor1-2 GST pulldown to determine a domain of sap30 interacting with ncor1 184469 N/A 184481 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 184475 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Demonstrates that NCor1 interacts with the N-terminus region (AA 1-167) of Sap30 and fails to interact with the C-terminus of Sap30 (AA 129-220). sap30-sin3a-1 Co-ip of in-vivo interaction between sap30 and sin3a 184470 N/A 184476 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells N/A 184475 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells physical association physical association false false false The proteins are endogenous. sap30-ncor1-3 GST pulldown to determine a domain of sap30 interacting with a domain of ncor1 184471 N/A 184475 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 184481 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Demonstrates that the N-terminus region of NCor1 (AA 1-312) was sufficient to interacts with the N-terminus region (AA 1-129) of Sap30. sap30-sin3a-5 Co-ip of interaction between the PAH3 domain of sin3a and sap30 184472 N/A 184475 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 184476 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Demonstrates that the PAH3 domain of Sin3a is sufficient for interaction with Sap30 and deletion of PAH3 resulted in loss of binding. sin3a-ncor1-1 GST pulldown showing interaction between a region of sin3a and the N-terminus of ncor1 184473 N/A 184476 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 184481 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Demonstrates that NCor1 (AA 1-132) binds a region on Sin3a (AA 524-851), which is different to the binding of Sap30 by Sin3a (occuring at the PAH3 region). sap30-sin3a-6 Y2H of interaction between sin3a and sap30 184474 N/A 184475 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 184476 unspecified role unspecified role prey prey pah binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Demonstrates that the PAH3 domain of Sin3a was sufficient for the isolation of Sap30 in a Y2H assay.