IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zachariae-1998-1 Mass spectrometric analysis of the anaphase-promoting complex from yeast: identification of a subunit related to cullins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Zachariae W., Shevchenko A., Andrews PD., Ciosk R., Galova M., Stark MJ., Mann M., Nasmyth K. A combined SDS-PAGE and MS approach used for identifying the participants. 1b not available in paper. Science (0036-8075) 1998 zachariae-1998-5 Mass spectrometric analysis of the anaphase-promoting complex from yeast: identification of a subunit related to cullins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Zachariae W., Shevchenko A., Andrews PD., Ciosk R., Galova M., Stark MJ., Mann M., Nasmyth K. A combined SDS-PAGE and MS approach used for identifying the participants. 1b not available in paper. Science (0036-8075) 1998 zachariae-1998-3 Mass spectrometric analysis of the anaphase-promoting complex from yeast: identification of a subunit related to cullins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Zachariae W., Shevchenko A., Andrews PD., Ciosk R., Galova M., Stark MJ., Mann M., Nasmyth K. A combined SDS-PAGE and MS approach used for identifying the participants. 1b not available in paper. Science (0036-8075) 1998 zachariae-1998-4 Mass spectrometric analysis of the anaphase-promoting complex from yeast: identification of a subunit related to cullins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Zachariae W., Shevchenko A., Andrews PD., Ciosk R., Galova M., Stark MJ., Mann M., Nasmyth K. A combined SDS-PAGE and MS approach used for identifying the participants. 1b not available in paper. Science (0036-8075) 1998 zachariae-1998-2 Mass spectrometric analysis of the anaphase-promoting complex from yeast: identification of a subunit related to cullins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zachariae W., Shevchenko A., Andrews PD., Ciosk R., Galova M., Stark MJ., Mann M., Nasmyth K. A combined SDS-PAGE and MS approach used for identifying the participants. 1b not available in paper. Science (0036-8075) 1998 cdc26_yeast Anaphase-promoting complex subunit CDC26 YFR036W CDC26 HIT3 SCD26 Cell division control protein 26 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIRRAPTTLQLSHDDVTSLIDDLNEQKLKQQLNIEKTKYFQGKNGGSLHSNTDFQDTSQNIEDNNNDNDNDIDEDDDMSSYNDKAASVAHTRVLNSLHLSTDSNTAHETSNANDNHNPFYIREE F41EECD2B56C4FB5 swm1_yeast Anaphase-promoting complex subunit SWM1 Spore wall maturation protein 1 Anaphase-promoting complex subunit 13 APC13 SWM1 YDR260C YD9320A.11 YD9320A.11c protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSSYRDSYFQYRHLPAPHHILYAEWNQDILALPDEVANITMAMKDNTRTDAEEGRAPQDGERNSNVRESAQGKALMTSEQNSNRYWNSFHDEDDWNLFNGMELESNGVVTFAGQAFDHSLNGGTNSRNDGANEPRKETITGSIFDRRITQLAYARNNGWHELALPQSR 7DD5FC4CBDE8BF19 apc11_yeast Anaphase-promoting complex subunit 11 D2900 YDL008W APC11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 99F8E8C6BC841934 apc10_yeast Anaphase-promoting complex subunit DOC1 Destruction of cyclin B protein 1 DOC1 APC10 YGL240W HRC283 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPETNNVFQDAILR F3C58B1BB986442D apc9_yeast Anaphase-promoting complex subunit 9 APC9 YLR102C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNQNGDKNEGKLFQLPSLPPWKTPRFNKANFNNFTTPLRKRSTRVINDDSMPITGEVLEERTADDLYGINMDVDEVDYLNTLSHIEEEKQYDYSPFCERNTLRESRIDSFLKAERAAHCLVFHKVGHLDGIDSYRPDIDIMCGEEANKYDSANPEGNGSMLLESVPGCNKEDLERLSRREFVTNSKPNMRRLDDIINHETNALKSFWNDSGLVNSLQSHHLHEEYLLLQEELKNVYKIKCHDRVPIESLRDKCRRHYSNEDSSFL 63423CC7CDFF47B2 apc4_yeast Anaphase-promoting complex subunit 4 APC4 YDR118W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHILVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGTLKDENLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRGENYENEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEKQNV CC7E3818FFD6AF25 cdc23_yeast Anaphase-promoting complex subunit CDC23 YHR166C CDC23 Cell division control protein 23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNDDSQDKIIHDIRIQLRKAATELSRWKLYGSSKWAAEALAGLAEAIDVDQTHSLADESPLRNKQGVPKQMFEIPQNGFGLSETEYDLYLLGSTLFDAKEFDRCVFFLKDVTNPYLKFLKLYSKFLSWDKKSQESMENILTTGKFTDEMYRANKDGDGSGNEDINQSGHQRANLKMVSNEHESQSNISSILKEINTFLESYEIKIDDDEADLGLALLYYLRGVILKQEKNISKAMSSFLKSLSCYSFNWSCWLELMDCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIMIKFFKLKVFEELNGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDIVKQDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYYRLAQLYEELEDLQECKKFMMKCVDVEELLEGIVTDETVKARLWLAIFEIKAGNYQLAYDYAMGVSSGTSQEIEEARMLARECRRHM 3C96FE2BC8097118 apc5_yeast Anaphase-promoting complex subunit 5 APC5 RMC1 YOR249C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKYGPLGITNFITPYDLCILILIHAHCSQDNGISVPTAVFLRLISPTRPSLEWNPLLKDNSNLRSSSIVPPPVLPILDNIIRILLDDKDGNKIALTLMGYLEAINGLDSINRLMMDLEKNCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKYQIGDFEMRETIWINLQNFKTVFKHTPLWLRFKDNVHIQKVKNCLLANDEISVEDQQMVEFFQHFNNGNDADSKTMNEENYGTLISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEEQSGLVFDLLDTLSLNDATKFPLIFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYFHISLLSLATFHSSFNECDAAINSFEEATRIARENKDMETLNLIMIWIINFIEVHPEYANRFYITVEQIIKYLKNSSDVEDANIFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNVPSQNFDLFQSLVSYEVKFWKELGYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFKALEEDDFLKVKQYLLKSESLELDYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCEEVADSNWRFKFEIESINVLLLSDVGIRSLPKIIKLIDEYKEIGNPLRCVILLLKLCEVLIQVGKSMEAECLISCNLSTILEFPFVRKKTDELLESLSVEEDRDVQMT 59310B47D5A1865F cdc27_yeast Anaphase-promoting complex subunit CDC27 APC3 CDC27 SNB1 YBL084C YBL0718 Cell division control protein 27 Anaphase-promoting complex subunit 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAVNPELAPFTLSRGIPSFDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSILDKSSVYWSDAVYLYALSLFLNKSYHTAFQISKEFKEYHLGIAYIFGRCALQLSQGVNEAILTLLSIINVFSSNSSNTRINMVLNSNLVHIPDLATLNCLLGNLYMKLDHSKEGAFYHSEALAINPYLWESYEAICKMRATVDLKRVFFDIAGKKSNSHNNNAASSFPSTSLSHFEPRSQPSLYSKTNKNGNNNINNNVNTLFQSSNSPPSTSASSFSSIQHFSRSQQQQANTSIRTCQNKNTQTPKNPAINSKTSSALPNNISMNLVSPSSKQPTISSLAKVYNRNKLLTTPPSKLLNNDRNHQNNNNNNNNNNNNNNNNNNNNNNNNIINKTTFKTPRNLYSSTGRLTTSKKNPRSLIISNSILTSDYSITLPEIMYNFALILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQVIIDELQKCHMQE A1ECA067AF8784E3 apc2_yeast Anaphase-promoting complex subunit 2 APC2 RSI1 YLR127C L3105 L3108 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIVKNGHKNS E559A0E28C784DE2 apc1_yeast Anaphase-promoting complex subunit 1 APC1 N1677 YNL172W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSKPSTRNDYLPRETHNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIEDQCLRQFTYNQKIIKAGYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWYANGVILERETSASFMDGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASGNKTDILQDFQLVLFPSDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTGLDAAGNSQKSGGISKDLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFALPSSCSRRSLSATLDRMGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYLNQTATSSKDIVLTEISSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHFCKIWLIDLLPDVLDSIPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSEGQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYITSPAFNISFIFLWQSAYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQEYKEIYERDLFQHLKQDSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATAAMGWPDLWQSYYVPKMDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCPFISFSRLVATDTQVELRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYPLGILVPLQNILKILEDKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYMLCKVPLAKNRSSLSKKPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKLNAGLIFSEDKRFTHVVSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVGWGAVAYATEKPISTQKWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGLRISKKATGITGSWIAFNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISIGLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRHKRMSDSIFAQLVSLLNVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDDLPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNNFGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTISVINVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQVTSNTNTPGNSDRERVDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLALGFLFLGSGQYALNTSTLESIAFLSMSVLPTYTTPHPLQELKHFWSMAVEPRCLVIKDISTGDAVNNVPIELVVEEDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDYSASDFFSGGTIIYIQRKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNTTSSQLVESLGIQDLTMVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWYKSFGPHDE 33D32EC47CA40E61 cdc16_yeast Anaphase-promoting complex subunit CDC16 CDC16 YKL022C Cell division control protein 16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGSNNADDDFDADMELE A096B34441083488 cdc16-apc1-2 interaction detected by Myc -tag CoIP, bait = cdc23 190994 N/A 190999 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191000 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false cdc16-apc1-3 interaction detected by Myc -tag CoIP, bait = cdc16 190994 N/A 191010 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190999 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191000 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false cdc27-apc1-4 interaction detected by Myc -tag CoIP, bait = cdc27 190994 N/A 191000 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190999 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc1-cdc16 interaction detected by Myc -tag CoIP, bait = apc1 190994 N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190999 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191000 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false cdc26-cdc16-1 interaction detected by Myc -tag CoIP, bait = cdc26 190994 N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190999 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191000 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false cdc16-apc1-7 interaction detected by Myc -tag CoIP, bait = apc1 190995 N/A 191009 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc2-apc1 interaction detected by Myc -tag CoIP, bait = apc2 190995 N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc4-apc1-1 interaction detected by Myc -tag CoIP, bait =apc4 190995 N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false cdc16-apc1-8 interaction detected by Myc -tag CoIP, bait = apc1 190995 N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false In cells lacking CDC26, CDC 27 is absent from the complex. apc2-apc1-1 interaction detected by Myc -tag CoIP, bait = apc2 190995 N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false In cells lacking CDC26, CDC 27 is absent from the complex. cdc16-apc1-4 interaction detected by Myc -tag CoIP, bait = cdc16 190996 N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc5-apc1 interaction detected by Myc -tag CoIP, bait = apc5 190996 N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc5-apc1-1 interaction detected by Myc -tag CoIP, bait = apc5 190996 N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false In the cells lacking APC9, CDC27 is not found to be a part of the complex. cdc16-apc1-5 interaction detected by Myc -tag CoIP, bait= cdc16 190996 N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false In the cells lacking APC9, CDC27 is not found to be part of the complex. cdc16-apc1-6 interaction detected by Myc -tag CoIP, bait = cdc16 190997 N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc11-apc1 interaction detected by Myc -tag CoIP, bait = apc11 190997 N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191001 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false apc11-apc1-1 interaction detected by Myc -tag CoIP, bait = apc1 190997 N/A 191001 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191005 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191002 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191003 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role bait bait s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role prey prey s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false cdc16-apc1 interaction detected by Myc -tag CoIP, bait = cdc16 190998 N/A 191005 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191004 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191006 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191007 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191008 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191009 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 191010 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false s35 radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false