IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tang-1997-1 PHYL acts to down-regulate TTK88, a transcriptional repressor of neuronal cell fates, by a SINA-dependent mechanism. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tang AH., Neufeld TP., Kwan E., Rubin GM. Cell (0092-8674) 1997 tang-1997-2 PHYL acts to down-regulate TTK88, a transcriptional repressor of neuronal cell fates, by a SINA-dependent mechanism. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tang AH., Neufeld TP., Kwan E., Rubin GM. Cell (0092-8674) 1997 sina_drome E3 ubiquitin-protein ligase sina sina CG9949 Seven in absentia protein RING-type E3 ubiquitin transferase sina protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV phyl_drome Protein phyllopod phyl CG10108 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFKFQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMVRPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSPKKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPTYQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDLDDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEAEAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV ttka_drome Protein tramtrack, alpha isoform ttk FTZ-F2 CG1856 Tramtrack p88 Repressor protein fushi tarazu protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDKPSPAAAAAGAGATGSESTATTPQLQRIQPYLVPQRNRSQAGGLLASAANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGNDYDDFDRENMMNDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKRSKNSKDHRVVSHHEDNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSETISLLEISDERESAPVHLPTILGLKIRAINTTTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQLRGGAKDPEVPPATRITGAVTPNAALNAEEQSKEMPKKNQDEVNACIGLHSLANAAEQQAAQVASTGNLHHQLLLHMAANNSMLNTTDYYQQQQQESPSSAGQFMDDDLELLSLNDQQDKSDEPDHEMVTLADENAGLPGYQGNEAEATPAQEDSPAAETATAPPPAPRSGKKGAKRPIQRRRVRRKAQSTLDDQAEHLTEMSVRGLDLFRYASVVEGVYRCTECAKENMQKTFKNKYSFQRHAFLYHEGKHRKVFPCPVCSKEFSRPDKMKNHLKMTHENFTPPKDIGAFSPLKYLISAAAAGDMHATIYQQQQDHYHRQLAEQLEQQNASFDSRDSSLILPDVKMEHAEDQDAEQEAELSDGGYDASNPAAAAAAMLSLQQDVIIKDEIQISPSPSPTPPASCAVAEGKSLALASTAQTAT ubcd1_drome Ubiquitin-conjugating enzyme E2-17 kDa eff UbcD1 CG7425 Ubiquitin-protein ligase Ubiquitin carrier protein Protein effete E2 ubiquitin-conjugating enzyme D1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM sina-sina Interaction detected by Y2H 177493 N/A 177495 unspecified role unspecified role bait bait N/A 177495 unspecified role unspecified role prey prey physical association physical association false false false sina-phyl-5 Interaction detected by Y2H 177493 N/A 177495 unspecified role unspecified role bait bait N/A 177496 unspecified role unspecified role prey prey physical association physical association false false false phyl-sina Interaction detected by Y2H 177493 N/A 177495 unspecified role unspecified role prey prey N/A 177496 unspecified role unspecified role bait bait physical association physical association false false false phyl-phyl Interaction detected by Y2H 177493 N/A 177496 unspecified role unspecified role bait bait N/A 177496 unspecified role unspecified role prey prey physical association physical association false false false phyl-ttk-4 Interaction detected by Y2H 177493 N/A 177497 unspecified role unspecified role bait bait N/A 177496 unspecified role unspecified role prey prey physical association physical association false false false ttk-sina 177493 N/A 177497 unspecified role unspecified role bait bait N/A 177495 unspecified role unspecified role prey prey physical association physical association false false false sina-eff Interaction detected by y2H 177493 N/A 177495 unspecified role unspecified role bait bait N/A 177498 unspecified role unspecified role prey prey physical association physical association false false false sina-eff-1 Interaction detected by y2H 177493 N/A 177495 unspecified role unspecified role prey prey N/A 177498 unspecified role unspecified role bait bait physical association physical association false false false phyl-ttk-5 Interaction detected by anti tag CoIP 177494 N/A 177496 unspecified role unspecified role prey prey polyoma epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 177497 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false phyl-ttk-6 Interaction detected by anti tag CoIP 177494 N/A 177496 unspecified role unspecified role bait bait polyoma epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 177497 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false