IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ labaer-1997-1 New functional activities for the p21 family of CDK inhibitors. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 labaer-1997-2 New functional activities for the p21 family of CDK inhibitors. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 labaer-1997-3 New functional activities for the p21 family of CDK inhibitors. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. The prey was in vitro translated and 35s radiolabel. The mixture with the bait and the prey was immunoprecipitated, washed and subjected to scintillation counting. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 labaer-1997-4 New functional activities for the p21 family of CDK inhibitors. human-184a1l5 Stable immortalized Homo sapiens cell line derived from normal human mammary epithelial cells 184a1l5 stable immortalized cell line derived from normal human mammary epithelial cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE cdn1c_human Cyclin-dependent kinase inhibitor 1C Cyclin-dependent kinase inhibitor p57 p57Kip2 CDKN1C KIP2 protein protein human Homo sapiens Human MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT cdn1a_human Cyclin-dependent kinase inhibitor 1 CDKN1A CAP20 CDKN1 CIP1 MDA6 PIC1 SDI1 WAF1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein 6 protein protein human Homo sapiens Human MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL cdk4-ccnd1-1 co-IP: bait = cyclin D1, prey = cdk4 174272 N/A 174276 unspecified role unspecified role bait bait N/A 174277 unspecified role unspecified role prey prey physical association physical association false false false Overexpression of p21-CIP (P38936) or p27-KIP (P46527) stimulates the complex formation. Overexpression of an amino-terminal 1-90 fragment of p21-CIP (P38936) is sufficient for the stimulation. cdk4-ccnd1-2 co-IP: bait = cdk4, prey = cyclin D1 174272 N/A 174277 unspecified role unspecified role bait bait N/A 174276 unspecified role unspecified role prey prey physical association physical association false false false Overexpression of p21-CIP (P38936) or p27-KIP1 (P46527) or p57-KIP2 (P49918) stimulates the complex formation. Overexpression of an amino-terminal 1-90 fragment of p21-CIP (P38936) is sufficient for the stimulation. cdk4-cdkn1c-1 co-IP: bait = cdk4, prey = KIP2 174272 N/A 174278 unspecified role unspecified role prey prey N/A 174277 unspecified role unspecified role bait bait physical association physical association false false false cdk4-cdkn1b-1 co-IP: bait = cdk4, prey = KIP1 174272 N/A 174277 unspecified role unspecified role bait bait N/A 174279 unspecified role unspecified role prey prey physical association physical association false false false cdk4-cdkn1a-1 co-IP: bait= p21-CIP1, prey = cdk4 174272 N/A 174277 unspecified role unspecified role bait bait N/A 174280 unspecified role unspecified role prey prey physical association physical association false false false cdk4-ccnd3-1 co-IP: bait = cdk4, prey = cyclin D3 174272 N/A 174281 unspecified role unspecified role prey prey N/A 174277 unspecified role unspecified role bait bait physical association physical association false false false Overexpression of p21-CIP (P38936) or p27-KIP1 (P46527) stimulates the complex formation cdk4-ccnd3-2 co-IP: bait = cyclin D3, prey = cdk4 174272 N/A 174281 unspecified role unspecified role bait bait N/A 174277 unspecified role unspecified role prey prey physical association physical association false false false Overexpression of p21-CIP (P38936) or p27-KIP1 (P46527) stimulates the complex formation cdk4-ccnd1-3 in vitro co-IP: bait = cyclin D1, prey = cdk4 174273 N/A 174277 unspecified role unspecified role prey prey glu glu tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 174276 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false Addition of p21-CIP (P38936) or p27-KIP (P46527) stimulates the complex formation. cdkn1a-ccnd1-1 in vitro co-IP: bait = cyclin D1, prey = p21-CIP1 174273 N/A 174280 unspecified role unspecified role prey prey glu glu tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 174276 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false cdkn1b-ccnd1-2 in vitro co-IP: bait = cyclin D1, prey = p27-KIP 174273 N/A 174276 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 174279 unspecified role unspecified role prey prey glu glu tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false cdk4-ccnd1-4 in vitro co-IP: bait = cyclin D1, prey = cdk4 174274 N/A 174276 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 174277 unspecified role unspecified role prey prey glu glu tag radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Addition of p21-CIP (P38936) or p27-KIP (P46527) stimulates the complex formation. Addition of p21-CIP1(P38936) alone increased affinity by 35 fold (2.10E-4 M) by reducing the rate of dissociation Addition of p27-KIP (P46527) alone increased affinity by 80 fold (2.10E-5 M) by reducing the rate of dissociation cdk4-ccnd1-5 co-IP: bait = cdk4, prey = cyclin D1, prey = p21-CIP1 174275 N/A 174277 unspecified role unspecified role bait bait N/A 174280 unspecified role unspecified role prey prey N/A 174276 unspecified role unspecified role prey prey association association false false false Cells were arrested in G0 by depletion of EGF. Reexposure to EGF stimuates synchronous reentery into the cell cycle. The cdk2 interactors could be detected 6 minutes after EGF stimulation. All proteins are endogenous