IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ davies-1996-2 Multiple interactions amongst floral homeotic MADS box proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Davies B., Egea-Cortines M., de Andrade Silva E., Saedler H., Sommer H. A directed yeast two hybrid assay was used in this study. Figure 8. Figure 9. sommer@mpiz-koeln.mpg.de A cDNA library of Antirrhinum floral tissues at various stages of development (infloresences to mature flowers) was used in this study. EMBO J. (0261-4189) 1996 davies-1996-1 Multiple interactions amongst floral homeotic MADS box proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Davies B., Egea-Cortines M., de Andrade Silva E., Saedler H., Sommer H. sommer@mpiz-koeln.mpg.de A cDNA library of Antirrhinum floral tissues at various stages of development (infloresences to mature flowers) was used in this study. EMBO J. (0261-4189) 1996 q41195_antma ple PLENA protein protein antma Antirrhinum majus (Garden snapdragon) MEFPNQDSESLRKNGRGKIEIKRIENITNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANNSVRATIERYKKASADSSNSVSTSEANTQFYQQEANKLRRQIREIQTSNRQMLGEGVSNMALKDLKSTEAKVEKAISRIRSKKNELLFAEIEHMQKRELELHNANMFLRAKIAEGERAQQQMNLMPGSDYQPMTSQSYDVRNFLPMNLMEPNQQQYSRHDQTALQLV q38733_antma DEFH200 protein protein antma Antirrhinum majus (Garden snapdragon) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLNTLERYQKCNYGPPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSLKHRLMDGSQISLQWNPNAEDHVGYGRQPSQPSADGFYHPLECEPTLHIGFQSDQITVAGAGPSVNNYISGWLP q38735_antma DEFH72 protein protein antma Antirrhinum majus (Garden snapdragon) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSNSGTMLKTLERYQKCNYGAPEANVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSLKHRLMEGSQISLQWNPNAHDMGYGRQAAAQPQGDGFFHPLECEPTLQMGFQSEITVGAAGPSVNNYNMTGWLP q38742_antma squamosa protein protein antma Antirrhinum majus (Garden snapdragon) MGRGKVQLKRIENKINRQVTFSKRRGGLLKKAHELSVLCDAEVALIVFSNKGKLFEYSTDSCMDRILEKYERYSFAERQLVSNEPQSPANWTLEYSKLKARIELLQRNHRHYMGEDLDSMSLKEIQSLEQQLDTALKNIRTRKNQLLYDSISELQHKEKAIQEQNTMLAKKIKEKEKEIAQQPQWEHHRHHTNASIMPPPPQYSMAPQFPCINVGNTYEGEGANEDRRNELDLTLDSLYSCHLGCFAA defa_antma Floral homeotic protein DEFICIENS DEFA protein protein antma Antirrhinum majus (Garden snapdragon) MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISPTTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQIVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLVDNEGDYNSVLGFPNGGPRIIALRLPTNHHPTLHSGGGSDLTTFALLE glob_antma Floral homeotic protein GLOBOSA GLO protein protein antma Antirrhinum majus (Garden snapdragon) MGRGKIEIKRIENSSNRQVTYSKRRNGIMKKAKEISVLCDAHVSVIIFASSGKMHEFCSPSTTLVDMLDHYHKLSGKRLWDPKHEHLDNEINRVKKENDSMQIELRHLKGEDITTLNYKELMVLEDALENGTSALKNKQMEFVRMMRKHNEMVEEENQSLQFKLRQMHLDPMNDNVMESQAVYDHHHHQNIADYEAQMPFAFRVQPMQPNLQERF q38734_antma DEFH49 protein protein antma Antirrhinum majus (Garden snapdragon) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTIERYQKSSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPLNMNDLEHLEHQLETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANHLQQSWGGGGDHSNAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHGLVPGWML ple-defh200-1 Directed yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the DEFH200 protein 207623 N/A 207625 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207626 unspecified role unspecified role prey prey physical association physical association false false false ple-defh72-1 Directed yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the DEFH72 protein 207623 N/A 207625 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207627 unspecified role unspecified role prey prey physical association physical association false false false ple-squa-1 Directed yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the SQUA (SQUAMOSA) protein 207623 N/A 207628 unspecified role unspecified role prey prey N/A 207625 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false def-glo-1 Directed yeast 2 hybrid analysis reveals interaction between DEF (DEFICIENS) protein and the GLO (GLOBOSA) protein 207623 N/A 207629 unspecified role unspecified role bait bait N/A 207630 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The authors stated that the C-terminal region of the MADS box domain stabalised interaction between DEF and GLO proteins. glo-def-1 Directed yeast 2 hybrid analysis reveals interaction between GLO (GLOBOSA) protein and the DEF (DEFICIENS) protein 207623 N/A 207629 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207630 unspecified role unspecified role bait bait physical association physical association false false false ple-defh49 Directed yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the DEFH49 protein 207623 N/A 207631 unspecified role unspecified role prey prey N/A 207625 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false def-glo Yeast 2 hybrid analysis reveals interaction between DEF (DEFICIENS) protein and the GLO (GLOBOSA) protein 207624 N/A 207629 unspecified role unspecified role bait bait N/A 207630 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false glo-def Yeast 2 hybrid analysis reveals interaction between GLO (GLOBOSA) protein and the DEF (DEFICIENS) protein 207624 N/A 207629 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 207630 unspecified role unspecified role bait bait physical association physical association false false false ple-squa Yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the SQUA (SQUAMOSA) protein 207624 N/A 207628 unspecified role unspecified role prey prey N/A 207625 unspecified role unspecified role bait bait physical association physical association false false false ple-defh200 Yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the DEFH200 protein 207624 N/A 207626 unspecified role unspecified role prey prey N/A 207625 unspecified role unspecified role bait bait physical association physical association false false false ple-defh72 Yeast 2 hybrid analysis reveals interaction between PLENA (PLE) protein and the DEFH72 protein 207624 N/A 207625 unspecified role unspecified role bait bait N/A 207627 unspecified role unspecified role prey prey physical association physical association false false false