IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ al_shamkhan-1996-1 OX40 is differentially expressed on activated rat and mouse T cells and is the sole receptor for the OX40 ligand. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined al-Shamkhani A., Birkeland ML., Puklavec M., Brown MH., James W., Barclay AN. The BIAcore analysis system was used in this experiment Eur. J. Immunol. (0014-2980) 1996 tnfl4_mouse Tumor necrosis factor ligand superfamily member 4 OX40 ligand Tnfsf4 Ox40l Txgp1l protein protein mouse Mus musculus Mouse MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL tnr4_rat Tumor necrosis factor receptor superfamily member 4 OX40L receptor OX40 antigen MRC OX40 Ox40 Txgp1l Tnfrsf4 protein protein rat Rattus norvegicus (Rat) Rat MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI ox40-ox40l The ox40 ligand (ox40L) binds to the ox40 protein. 174521 N/A 174522 unspecified role unspecified role prey prey region extracellular domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n terminal sCD4-OX40L was immobilzed to a CD4 mAb (covalently bound) to the sensor chip uncategorized protein modification uncategorized protein modification n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crisp-kidney Cricetidae sp. kidney kidney [Renal] N/A 174523 unspecified role unspecified role bait bait region soluble form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false crisp-kidney Cricetidae sp. kidney kidney [Renal] direct interaction direct interaction false false false