IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ strom-2006-1 Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Strom A., Diecke S., Hunsmann G., Stuke AW. Whole brain tissue of a PrP knockout mouse was homogenized and cytosolic proteins were separated by sucrose density gradient centrifugation - the fraction containing the PrP-binding proteins was detected and separated by 2-DE. In addition to MALDI-TOF MS analysis, antibodies specific for the identified proteins confirmed the identification of the prey. Figures 2 and 3 and Table 1. astrom@ohri.ca Proteomics (1615-9853) 2006 1532..1534 1532..1544 2006-09-22: Only interaction involving solely Proteins were exported. Only protein-protein interactions 3 imex curation strom-2006-2 Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry. human-l-540 Homo sapiens Hodgkin's Lymphoma L-540 cell line l-540 Human Hodgkin's Lymphoma cell line, L-540. far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Strom A., Diecke S., Hunsmann G., Stuke AW. Whole brain tissue of a PrP knockout mouse was homogenized and cytosolic proteins were separated by sucrose density gradient centrifugation - the fraction containing the PrP-binding proteins was detected and separated by 2-DE. In addition to MALDI-TOF MS analysis, antibodies specific for the identified proteins confirmed the identification of the prey. Figures 2 and 3 and Table 1. astrom@ohri.ca Proteomics (1615-9853) 2006 1532..1534 1532..1544 2006-09-22: Only interaction involving solely Proteins were exported. Only protein-protein interactions 3 imex curation prio_human Major prion protein PrP27-30 PrP33-35C ASCR PRNP PRIP PRP ALTPRP protein protein human Homo sapiens Human MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG aldoc_mouse Fructose-bisphosphate aldolase C Brain-type aldolase Aldolase 3 Zebrin II Scrapie-responsive protein 2 Aldoc Aldo3 Scrg2 protein protein mouse Mus musculus Mouse MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYIANHAY roa2_mouse Heterogeneous nuclear ribonucleoproteins A2/B1 Hnrnpa2b1 Hnrpa2b1 protein protein mouse Mus musculus Mouse MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG roa2_human Heterogeneous nuclear ribonucleoproteins A2/B1 HNRNPA2B1 HNRPA2B1 protein protein human Homo sapiens Human MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY prnp-aldoc-1 Interaction of the cellular prion protein and aldoase C, detected by far-Western blotting. 258708 N/A 258710 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 258711 unspecified role unspecified role prey prey physical association physical association false false false prnp-hnrpa2b1-1 Interaction of cellular prion protein and hnRNP A2/B1 258708 N/A 258710 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 258712 unspecified role unspecified role prey prey physical association physical association false false false prnp-hnrpa2b1-2 Interaction of Cellular Prion protein with human hnRNP A2/B1, detected by far-Western blotting. 258709 N/A 258713 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 258714 unspecified role unspecified role prey prey physical association physical association false false false 36 kDa.