IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ vignols-2005-1 A yeast two-hybrid knockout strain to explore thioredoxin-interacting proteins in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vignols F., Brehelin C., Surdin-Kerjan Y., Thomas D., Meyer Y. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Interactions were quantified accordingly to the yeast growth on medium without histidine and in presence of 3AT : weak (+ or +/-), medium (++), strong (+++), very strong (++++) A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. fig 2, fig 4, table 1 vignols@univ-perp.fr Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 vignols-2005-2 A yeast two-hybrid knockout strain to explore thioredoxin-interacting proteins in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down fingerprinting peptide massfingerprinting fingerprinting Vignols F., Brehelin C., Surdin-Kerjan Y., Thomas D., Meyer Y. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Interactions were quantified accordingly to the yeast growth on medium without histidine and in presence of 3AT : weak (+ or +/-), medium (++), strong (+++), very strong (++++) A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. fig 2, fig 4, table 1 vignols@univ-perp.fr Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 ahp1_yeast Peroxiredoxin AHP1 AHP1 Thioredoxin peroxidase type II Cytoplasmic thiol peroxidase 3 Thiol-specific antioxidant II Alkyl hydroperoxide reductase Thioredoxin-dependent peroxiredoxin AHP1 L2916 L9354.5 YLR109W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL 11B730781306A015 trx1_yeast Thioredoxin-1 TRX1 TRX2 YLR043C Thioredoxin I Thioredoxin-2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA met16_yeast Phosphoadenosine phosphosulfate reductase MET16 PAdoPS reductase 3'-phosphoadenylylsulfate reductase PAPS reductase, thioredoxin dependent P9325.8 YPR167C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDMLSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFASKYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNGILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGKAKTECGIHEASRFAQFLKQDA 202AF2C20829513C msra_yeast Peptide methionine sulfoxide reductase MXR1 Protein-methionine-S-oxide reductase Peptide-methionine (S)-S-oxide reductase YER042W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPSSVSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYACPTHYLREM trx2_yeast Thioredoxin-2 TRX2 TRX1 G7746 YGR209C Thioredoxin II Thioredoxin-1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 071503762C90D451 tsa1_yeast Peroxiredoxin TSA1 TSA1 TPX1 TSA YML028W Cytoplasmic thiol peroxidase 1 Thiol-specific antioxidant protein 1 ZRG14 Protector protein Thioredoxin peroxidase type Ia Thioredoxin-dependent peroxide reductase Thioredoxin-dependent peroxiredoxin TSA1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK 9ACF40E410F2C04A trxh3_arath Thioredoxin H3 TRX3 At5g42980 MBD2.18 Thioredoxin 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA trxh2_arath Thioredoxin H2 TRX2 At5g39950 MYH19.14 Thioredoxin 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGALSTVFGSGEDATAAGTESEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSKLRA if4e_yeast Eukaryotic translation initiation factor 4E CDC33 mRNA cap-binding protein eIF-4F 25 kDa subunit TIF45 YOL139C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL 5B9162E1BD0B1BDE trxb1_yeast Thioredoxin reductase 1 D9476.5 YDR353W TRR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSLE 9F9E58A4BAD859E1 adh1_yeast Alcohol dehydrogenase 1 ADH1 ADC1 YOL086C O0947 Alcohol dehydrogenase I YADH-1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK F14AE24B5D8D12A5 g3p3_yeast Glyceraldehyde-3-phosphate dehydrogenase 3 TDH3 GPD3 YGR192C G7576 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA 6CFFFEE7061BC36F dld3_yeast D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3 YEL071W DLD3 D-lactate ferricytochrome C oxidoreductase (R)-2-hydroxyglutarate--pyruvate transhydrogenase D-lactate dehydrogenase [cytochrome] 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAHPVAQLTAEAYPKVKRNPNFKVLDSEDLAYFRSILSNDEILNSQAPEELASFNQDWMKKYRGQSNLILLPNSTDKVSKIMKYCNDKKLAVVPQGGNTDLVGASVPVFDEIVLSLRNMNKVRDFDPVSGTFKCDAGVVMRDAHQFLHDHDHIFPLDLPSRNNCQVGGVVSTNAGGLNFLRYGSLHGNVLGLEVVLPNGEIISNINALRKDNTGYDLKQLFIGAEGTIGVVTGVSIVAAAKPKALNAVFFGIENFDTVQKLFVKAKSELSEILSAFEFMDRGSIECTIEYLKDLPFPLENQHNFYVLIETSGSNKRHDDEKLTAFLKDTTDSKLISEGMMAKDKADFDRLWTWRKSVPTACNSYGGMYKYDMSLQLKDLYSVSAAVTERLNAAGLIGDAPKPVVKSCGYGHVGDGNIHLNIAVREFTKQIEDLLEPFVYEYIASKKGSISAEHGIGFHKKGKLHYTRSDIEIRFMKDIKNHYDPNGILNPYKYI 4809F74EDF07F520 trx1-ahp1-1 Y2H bait= yeast TRX1, prey= yeast AHP1 252096 N/A 252098 unspecified role unspecified role prey prey N/A 252099 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. medium medium trx1-met16-1 Y2H bait= yeast TRX1, prey= yeast MET16 252096 N/A 252100 unspecified role unspecified role prey prey P18408:p.Cys245Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 252099 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. strong strong trx1-mxr1-2 Y2H bait= yeast TRX1, prey= yeast MSRA 252096 N/A 252099 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252101 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. weak weak trx2-mxr1-3 Y2H bait= yeast TRX2, prey= yeast MSRA 252096 N/A 252102 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252101 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. medium medium trx2-met16-1 Y2H bait= yeast TRX2, prey= yeast MET16 252096 N/A 252100 unspecified role unspecified role prey prey P18408:p.Cys245Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 252102 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. medium medium trx2-tsa1-1 Y2H bait= yeast TRX2, prey= yeast TSA1 252096 N/A 252102 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252103 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. very strong very strong trx2-ahp1-1 Y2H bait= yeast TRX2, prey= yeast AHP1 252096 N/A 252098 unspecified role unspecified role prey prey N/A 252102 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. strong strong trx3-ahp1-1 Y2H bait= arabidopsis TRXh3, prey= yeast AHP1 252096 N/A 252098 unspecified role unspecified role prey prey N/A 252104 unspecified role unspecified role bait bait Q42403:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. medium medium trx3-mrx1-1 Y2H bait= arabidopsis TRXh3, prey= yeast MSRA 252096 N/A 252104 unspecified role unspecified role bait bait Q42403:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252101 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. weak weak trx2-mrx1-1 Y2H bait= arabidopsis TRXh2, prey= yeast MSRA 252096 N/A 252101 unspecified role unspecified role prey prey N/A 252105 unspecified role unspecified role bait bait Q38879:p.Cys62Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. weak weak trx2-met16-2 Y2H bait= arabidopsis TRXh2, prey= yeast MET16 252096 N/A 252105 unspecified role unspecified role bait bait Q38879:p.Cys62Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252100 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. medium medium trx1-ahp1-2 Pull-down in yeast expressing Yeast TRX1 252097 N/A 252103 unspecified role unspecified role prey prey N/A 252106 unspecified role unspecified role prey prey N/A 252098 unspecified role unspecified role prey prey N/A 252107 unspecified role unspecified role prey prey N/A 252100 unspecified role unspecified role prey prey N/A 252108 unspecified role unspecified role prey prey N/A 252109 unspecified role unspecified role prey prey N/A 252099 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false trx2-ahp1-2 Pull-down in yeast expressing Yeast TRX2 252097 N/A 252110 unspecified role unspecified role prey prey N/A 252102 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 252103 unspecified role unspecified role prey prey N/A 252106 unspecified role unspecified role prey prey N/A 252098 unspecified role unspecified role prey prey N/A 252100 unspecified role unspecified role prey prey N/A 252108 unspecified role unspecified role prey prey N/A 252109 unspecified role unspecified role prey prey N/A 252107 unspecified role unspecified role prey prey association association false false false The participant EBI-2382(P38013) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. trx2-ahp1-3 Pull-down in yeast expressing Arabidopsis AtTRXh2 252097 N/A 252105 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q38879:p.Cys62Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252098 unspecified role unspecified role prey prey N/A 252103 unspecified role unspecified role prey prey N/A 252106 unspecified role unspecified role prey prey N/A 252100 unspecified role unspecified role prey prey N/A 252107 unspecified role unspecified role prey prey association association false false false The participant EBI-2382(P38013) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. trx3-ahp1-4 Pull-down in yeast expressing Arabidopsis AtTRXh3 252097 N/A 252108 unspecified role unspecified role prey prey N/A 252106 unspecified role unspecified role prey prey N/A 252104 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q42403:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 252098 unspecified role unspecified role prey prey association association false false false