MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cloutier-2005-2 Characterization of a poplar NIMA-related kinase PNek1 and its potential role in meristematic activity. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cloutier M., Vigneault F., Lachance D., Séguin A. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation cloutier-2005-1 Characterization of a poplar NIMA-related kinase PNek1 and its potential role in meristematic activity. yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Cloutier M., Vigneault F., Lachance D., Séguin A. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation q8sa64_popcn protein protein popcn Populus canescens MEQYEVLEQIGKGSFGSALLVKHKHEKKKYVLKKIRLARQTDRSRRSAHQEKELISRIRNPFIVEYKDSWVEKGCYVCIIIGYCEGGDMAEAIKKANGVHFPEEKLCKWLVQLLMALDYLHMNHILHRDVKCSNIFLTKGQDIRLGDFGLAKILTSDDLASSVVGTPSYMCPELLADIPYGSKSDIWSLGCCIYEMTSLKPAFKAFDMQALINKINKSIVAPLPTKYSGAFRGLVKSMLRKNPELRPSAAELLRHPHLQPYVLKIHIKMNSPRQNTLPFQWPEPHYMKKTKFLVPEDNPLKAHREKRYSLSNDRALNPSISAAEQDSVCSTEGIHDTPSYLNQSLSDSSIESSHEGTVICRSIASKPSNFAKTTKPAPTKASVTTRRRTEPVKKRESLPVTRTPTKKSNPTTRRTSLPLPSRTAIQNSAHGTNNSILLQIKSPDVSVNAPRIDRIAEFPLASYDKPYLPFRRTSSTSAQGSSNSLHHGDRSITKDKCTVQISDRTSAKPNFTEAWQGIEHGMFQVDEENGSNSSNQNATAGASSRTSSDIRRRRFDTSSFQQRAEALEGLLEFSARLLQDARYDELGVLLKPFGPGKVSPRETAIWLTKSFKENTAKTEDC mint q9xew5_popcn 14-3-3P20-5 protein protein popcn Populus canescens MDSSKDRENFVYVAKLAEQAERYDEMVDAMKKVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNETNVKRIKEYRKKVEAELTGVCNDIMTVIDEHLIPSSIPGESAVFYYKMKGDYYRYLAEFKSGNERKEAADQSLKAYETATSTAARDLSPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQSFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGEDQKMETSAKAGGGEDAE mint 14_3_3p20_5-q8sa64-1 210476 q8sa64_9rosi 210478 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8SA64:p.Ser416Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 q9xew5_9rosi 210479 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region feature prediction feature prediction certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F2A mint 14_3_3p20_5-q8sa64_popcn-1 210476 N/A 210478 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8SA64:p.Lys33Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 210479 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region feature prediction feature prediction certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F2A mint q8sa64-q8sa64 210477 q8sa64_9rosi 210478 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q8sa64_9rosi 210478 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false coiled coiled domain Q8SA64:p.Thr389Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F2A mint