MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint moon-2005b-1 Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation moon-2005b-2 Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. in vitro In vitro phage display phage display predetermined predetermined participant predetermined Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation moon-2005b-3 Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation moon-2005b-4 Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation ubp6_arath Ubiquitin carboxyl-terminal hydrolase 6 UBP6 F19C24.8 At1g51710 Ubiquitin thioesterase 6 Ubiquitin-specific-processing protease 6 Deubiquitinating enzyme 6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPTVSVKWQKKVLDGIEIDVSLPPYVFKAQLYDLTGVPPERQKIMVKGGLLKDDGDWAAIGVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLGYSAGLVNLGNTCYMNSTVQCLKSVPELKSALSNYSLAARSNDVDQTSHMLTVATRELFGELDRSVNAVSPSQFWMVLRKKYPQFSQLQNGMHMQQDAEECWTQLLYTLSQSLKAPTSSEGADAVKALFGVNLQSRLHCQESGEESSETESVYSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWKRESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGSKDSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWIQYDDDNPSMQREEDITKLSGGGDWHMAYITMYKARFVSM Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins mint calm2_arath Calmodulin-2/3/5 CAM2 CAL1 At2g41110 T3K9.12 CAM3 At3g56800 T8M16.130 CAM5 TCH1 At2g27030 T20P8.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK ubp6-cam2 209254 ubp6_arath 209258 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified Q949Y0:p.Trp175Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q949Y0:p.Leu178Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 calm2_arath 209259 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false Interaction in presence of Ca2+ F2 F4 mint cam2-ubp6 209255 ubp6_arath 209258 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 calm2_arath 209259 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false NFA mint cam2-ubp6-1 209256 ubp6_arath UBP6 209258 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false calm2_arath 209259 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3b mint cam2-ubp6-2 209257 ubp6_arath UBP6 209258 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false calm2_arath 209259 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3c mint