MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint d_az_moreno-2005-1 An NMR-based docking model for the physiological transient complex between cytochrome f and cytochrome c6. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Díaz-Moreno I., Díaz-Quintana A., Ubbink M., De la Rosa MA. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation cyc6_noss1 Cytochrome c6 petJ cytA alr4251 Soluble cytochrome f Cytochrome c553 Cytochrome c-553 protein protein noss1 Nostoc sp. (strain PCC 7120 / UTEX 2576) MKKIFSLVLLGIALFTFAFSSPALAADSVNGAKIFSANCASCHAGGKNLVQAQKTLKKADLEKYGMYSAEAIIAQVTNGKNAMPAFKGRLKPEQIEDVAAYVLGKADADWK Functions as an electron carrier between membrane-bound cytochrome b6-f and photosystem I in oxygenic photosynthesis mint petj-petj 189122 cyc6_anasp 189123 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 cyc6_anasp 189123 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false F1 The interaction occurs in between the precursor and the soluble fragment of the protein mint