IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gingerich-2005-2 Cullins 3a and 3b assemble with members of the broad complex/tramtrack/bric-a-brac (BTB) protein family to form essential ubiquitin-protein ligases (E3s) in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gingerich DJ., Gagne JM., Salter DW., Hellmann H., Estelle M., Ma L., Vierstra RD. Directed yeast two hybrid Figure 4 (a). vierstra@wisc.edu The following arabidopsis cDNA libraries were used in this study, (1) 3 day old etiolated seedling and (2) a composite library from biotic and abiotic stressed arabidopsis seedlings. J. Biol. Chem. (0021-9258) 2005 gingerich-2005-1 Cullins 3a and 3b assemble with members of the broad complex/tramtrack/bric-a-brac (BTB) protein family to form essential ubiquitin-protein ligases (E3s) in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gingerich DJ., Gagne JM., Salter DW., Hellmann H., Estelle M., Ma L., Vierstra RD. vierstra@wisc.edu The following arabidopsis cDNA libraries were used in this study, (1) 3 day old etiolated seedling and (2) a composite library from biotic and abiotic stressed arabidopsis seedlings. J. Biol. Chem. (0021-9258) 2005 y4845_arath BTB/POZ domain-containing protein At4g08455 At4g08455 T15F16.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRCISCREEYLPRNAGTCKECYVEAGETEEELKREIDDLKAKVAFLRLSSSLDHGTSSTSRSFTDVVLIASEDNAGSPPIPAHKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVYYLYTAEACLDEQMACDLLVMSEKYQVKHLKSYCERFLVTKLSPDNSLMTYAFAHQHNAKHVLDAALSQIVENMDKLTKREEYMELVEKDPRLIVEIYEAYLSKQVNTAAGGTSTSKTS cul3a_arath Cullin-3A CUL3A T2P11.2 CUL3 At1g26830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNQKKRNFQIEAFKHRVVVDPKYADKTWQILERAIHQIYNQDASGLSFEELYRNAYNMVLHKFGEKLYTGFIATMTSHLKEKSKLIEAAQGGSFLEELNKKWNEHNKALEMIRDILMYMDRTYIESTKKTHVHPMGLNLWRDNVVHFTKIHTRLLNTLLDLVQKERIGEVIDRGLMRNVIKMFMDLGESVYQEDFEKPFLDASSEFYKVESQEFIESCDCGDYLKKSEKRLTEEIERVAHYLDAKSEEKITSVVEKEMIANHMQRLVHMENSGLVNMLLNDKYEDLGRMYNLFRRVTNGLVTVRDVMTSHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDKIINTAFGNDKTFQNALNSSFEYFINLNARSPEFISLFVDDKLRKGLKGITDVDVEVILDKVMMLFRYLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSEDTMRGFYGSHPELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGTADIKAIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACVKGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETEPEKQETRQRVEEDRKPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLERDSTDRKLYRYLA bpm1_arath BTB/POZ and MATH domain-containing protein 1 At5g19000 BPM1 Protein BTB-POZ AND MATH DOMAIN 1 T16G12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTTRVCSEVSSGSSKSLSQSLTVSTSTTETVNGFHEFKICGYSLAKGVGVGKYVASDTFMVGGYSWAIYFYPDGKSPEDNSSYVSLFIALASEGADVRALFELTLVDQSGNGKHKVHSHFGRALDSGPYTLKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRYYNIPVPVSNLGQQLGNLLESGKGCDVVFQVDGETFNAHKLVLATRSPVFNAQLFGPLGDRNTKCITIEDMEAPIFKVLLHFIYWDELPDMQELIGTDSTLASTLVAQHLLAAADRYALERLKAICESKLCEGVAINTVATTLALAEQHHCLQLKAVCLKFVALPENLKAVMQTDGFDYLKESCPSLLTELLQYVARLSEHSVIVSGHRKEIFADGCDASGRRVKPRLH q9xh28_arath F10A2.10 F10A2_10 At4g07670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTLSQVSLVVYANYGRVEDFVRLKKDMGVNVSGAVVIARYGQIYKVDIVNNAYEAGAVGVVIYTNKRDYGGDEWFPASKWMPPSGFQVGTVYNGLGDPTTPGWASVDGCERLSDEAVELSGDVPLIPSLPVSAADAEVILKTIVGDVGPGPGILNLSYIVTKIQNVIGVIEGEEEPDRYVILRNHRDTWTFRAVDPNSGTAVLMEASKSYLQHIAQRLDKLQKRGWKPRRTIILCNWDAEEYGLVSSLSEISYWLFFFIIVYTNTSNISLKLHWKQNES cul3b_arath Cullin-3B CUL3B T6C23.13 At1g69670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNQKKRNFQIEAFKQRVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMVLHKYGDKLYTGLVTTMTFHLKEICKSIEEAQGGAFLELLNRKWNDHNKALQMIRDILMYMDRTYVSTTKKTHVHELGLHLWRDNVVYSSKIQTRLLNTLLDLVHKERTGEVIDRVLMRNVIKMFMDLGESVYQDDFEKPFLEASAEFYKVESMEFIESCDCGEYLKKAEKPLVEEVERVVNYLDAKSEAKITSVVEREMIANHVQRLVHMENSGLVNMLLNDKYEDMGRMYSLFRRVANGLVTVRDVMTLHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDRIINMAFNNDKTFQNALNSSFEYFVNLNTRSPEFISLFVDDKLRKGLKGVGEEDVDLILDKVMMLFRYLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERNLIVKLKTECGYQFTSKLEGMFTDMKTSHDTLLGFYNSHPELSEGPTLVVQVLTTGSWPTQPTIQCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGTADIKAVFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPTPDLKRCLQSMACVKGKNVLRKEPMSKEIAEEDWFVVNDRFASKFYKVKIGTVVAQKETEPEKQETRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNIIAEVTKQLQTRFLANPTEIKKRIESLIERDFLERDNTDRKLYRYLA skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE ufo_arath Protein UNUSUAL FLORAL ORGANS F-box only protein 1 UFO At1g30950 F17F8.16 FBX1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA rbx1a_arath RING-box protein 1a ROC1 RBX1a-At At-Rbx1;1 RBX1-2 Protein RING of cullins 1 RBX1A At5g20570 F7C8.160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLDSDVTMIPAGEASSSVAASSSNKKAKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH cul3a-q6dbn1-1 Directed yeast 2 hybrid analysis reveals interaction between the Cul3a protein and the Q6DBN1 protein 206540 N/A 206542 unspecified role unspecified role prey prey N/A 206543 unspecified role unspecified role bait bait physical association physical association false false false cul3a-q8l765-2 Directed yeast 2 hybrid analysis reveals interaction between the Cul3a protein and the Q8L765 protein 206540 N/A 206544 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 206543 unspecified role unspecified role bait bait physical association physical association false false false cul3a-q9xh28-1 Directed yeast 2 hybrid analysis reveals interaction between the Cul3a protein and the Q9XH28 protein 206540 N/A 206543 unspecified role unspecified role bait bait N/A 206545 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cul3b-q6dbn1-1 Directed yeast 2 hybrid analysis reveals interaction between the Cul3b protein and the Q6DBN1 protein 206540 N/A 206546 unspecified role unspecified role bait bait N/A 206542 unspecified role unspecified role prey prey physical association physical association false false false cul3b-q8l765-1 Directed yeast 2 hybrid analysis reveals interaction between the Cul3b protein and the Q8L765 protein 206540 N/A 206546 unspecified role unspecified role bait bait N/A 206544 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false cul3b-q9xh28-1 Directed yeast 2 hybrid analysis reveals interaction between the Cul3b protein and the Q9XH28 protein 206540 N/A 206546 unspecified role unspecified role bait bait N/A 206545 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ufo-ask1-2 Directed yeast 2 hybrid analysis reveals interaction between UNUSUAL FLORAL ORGANS (UFO) protein and Serine/threonine-protein kinase ASK1 206540 N/A 206547 unspecified role unspecified role prey prey N/A 206548 unspecified role unspecified role bait bait physical association physical association false false false cul1-ask1-2 Directed yeast 2 hybrid analysis reveals interaction between the Cullin1 protein and the ASK1protein 206540 N/A 206549 unspecified role unspecified role bait bait N/A 206547 unspecified role unspecified role prey prey physical association physical association false false false cul1-rbx-1 Directed yeast two hybrid assay reveals interaction between the CUL1 and RBX proteins 206540 N/A 206549 unspecified role unspecified role bait bait N/A 206550 unspecified role unspecified role prey prey physical association physical association false false false cul3a-q6dbn1 Yeast 2 hybrid analysis reveals interaction between the Cul3a protein and the Q6DBN1 protein 206541 N/A 206543 unspecified role unspecified role bait bait N/A 206542 unspecified role unspecified role prey prey physical association physical association false false false This interaction was detected when Cul3a bait was used to screen a cDNA library consisting of aliquots of cDNA libraries from arabidposis seedlings under biotic or abiotic stress. cul3a-q8l765-1 Yeast 2 hybrid analysis reveals interaction between the Cul3a protein and the Q8L765 protein 206541 N/A 206543 unspecified role unspecified role bait bait N/A 206544 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false This interaction was detected when Cul3a bait was used to screen a cDNA library from 3 day old etiolated seedlings. cul3a-q9xh28 Yeast 2 hybrid analysis reveals interaction between the Cul3a protein and the Q9XH28 protein 206541 N/A 206543 unspecified role unspecified role bait bait N/A 206545 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false This interaction was detected when Cul3a bait was used to screen a cDNA library from 3 day old etiolated seedlings. cul3b-q9xh28 Yeast 2 hybrid analysis reveals interaction between the Cul3b protein and the Q9XH28 protein 206541 N/A 206546 unspecified role unspecified role bait bait N/A 206545 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false This interaction was detected when Cul3a bait was used to screen a cDNA library from 3 day old etiolated seedlings. cul3b-q6dbn1 Yeast 2 hybrid analysis reveals interaction between the Cul3b protein and the Q6DBN1 protein 206541 N/A 206546 unspecified role unspecified role bait bait N/A 206542 unspecified role unspecified role prey prey physical association physical association false false false This interaction was detected when Cul3a bait was used to screen a cDNA library consisting of aliquots of cDNA libraries from arabidposis seedlings under biotic or abiotic stress. cul3b-q8l765 Yeast 2 hybrid analysis reveals interaction between the Cul3b protein and the Q8L765 protein 206541 N/A 206546 unspecified role unspecified role bait bait N/A 206544 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false This interaction was detected when Cul3a bait was used to screen a cDNA library from 3 day old etiolated seedlings.