MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint park-2005-3 WRKY group IId transcription factors interact with calmodulin. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag visualisation tag visualisation Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. Tag visualisation performed using a peroxidase assay. colim@gsnu.ac.kr, choslab@gsnu.ac.kr Arabidopsis Lamda ZAPII cDNA expression library FEBS Lett. (0014-5793) 2005 Only protein-protein interactions imex curation park-2005-1 WRKY group IId transcription factors interact with calmodulin. in vitro In vitro lambda phage lambda phage display lambda phage nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. colim@gsnu.ac.kr, choslab@gsnu.ac.kr Arabidopsis Lamda ZAPII cDNA expression library FEBS Lett. (0014-5793) 2005 Only protein-protein interactions imex curation park-2005-5 WRKY group IId transcription factors interact with calmodulin. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. colim@gsnu.ac.kr, choslab@gsnu.ac.kr Arabidopsis Lamda ZAPII cDNA expression library FEBS Lett. (0014-5793) 2005 Only protein-protein interactions imex curation wrky7_arath Probable WRKY transcription factor 7 WRKY7 WRKY DNA-binding protein 7 T22A6.70 At4g24240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTVELMMSSYSGGGGGGDGFPAIAAAAKMEDTALREAASAGIHGVEEFLKLIGQSQQPTEKSQTEITAVTDVAVNSFKKVISLLGRSRTGHARFRRAPASTQTPFKQTPVVEEEVEVEEKKPETSSVLTKQKTEQYHGGGSAFRVYCPTPIHRRPPLSHNNNNNQNQTKNGSSSSSPPMLANGAPSTINFAPSPPVSATNSFMSSHRCDTDSTHMSSGFEFTNPSQLSGSRGKPPLSSASLKRRCNSSPSSRCHCSKKRKSRVKRVIRVPAVSSKMADIPSDEFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDAMMLIVTYEGDHNHALVLETTTMNHDKTL calm2_arath Calmodulin-2/3/5 CAM2 CAL1 At2g41110 T3K9.12 CAM3 At3g56800 T8M16.130 CAM5 TCH1 At2g27030 T20P8.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK wrk11_arath Probable WRKY transcription factor 11 WRKY11 WRKY DNA-binding protein 11 F3L17.120 At4g31550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVDLMRFPKIDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKTVISLLNRTGHARFRRGPVHSTSSAASQKLQSQIVKNTQPEAPIVRTTTNHPQIVPPPSSVTLDFSKPSIFGTKAKSAELEFSKENFSVSLNSSFMSSAITGDGSVSNGKIFLASAPLQPVNSSGKPPLAGHPYRKRCLEHEHSESFSGKVSGSAYGKCHCKKSRKNRMKRTVRVPAISAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGEHRHNQSAMQENISSSGINDLVFASA wrk15_arath Probable WRKY transcription factor 15 WRKY15 WRKY DNA-binding protein 15 T20D16.5 At2g23320 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVELMTRNYISGVGADSFAVQEAAASGLKSIENFIGLMSRDSFNSDQPSSSSASASASAAADLESARNTTADAAVSKFKRVISLLDRTRTGHARFRRAPVHVISPVLLQEEPKTTPFQSPLPPPPQMIRKGSFSSSMKTIDFSSLSSVTTESDNQKKIHHHQRPSETAPFASQTQSLSTTVSSFSKSTKRKCNSENLLTGKCASASSSGRCHCSKKRKIKQRRIIRVPAISAKMSDVPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAADDSSMLIVTYEGDHNHSLSAADLAGAAVADLILESS wrk17_arath Probable WRKY transcription factor 17 WRKY17 WRKY DNA-binding protein 17 F25P17.13 At2g24570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTVDIMRLPKMEDQTAIQEAASQGLKSMEHLIRVLSNRPEERNVDCSEITDFTVSKFKKVISLLNRSGHARFRRGPVHSPPSSSVPPPVKVTTPAPTQISAPAPVSFVQANQQSVTLDFTRPSVFGAKTKSSEVVEFAKESFSVSSNSSFMSSAITGDGSVSKGSSIFLAPAPAVPVTSSGKPPLSGLPYRKRCFEHDHSEGFSGKISGSGNGKCHCKKSRKNRMKRTVRVPAVSAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRHHQSTMQEHVTPSVSGLVFGSA wrk21_arath Probable WRKY transcription factor 21 WRKY21 At2g30590 T6B20.6 T06B20.6 WRKY DNA-binding protein 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEIEGTNRAAVESCHRVLNLLHRSQQQDHVGFEKNLVSETREAVIRFKRVGSLLSSSVGHARFRRAKKLQSHVSQSLLLDPCQQRTTEVPSSSSQKTPVLRSGFQELSLRQPSDSLTLGTRSFSLNSNAKAPLLQLNQQTMPPSNYPTLFPVQQQQQQQQQQQQQEQQQQQQQQQQQFHERLQAHHLHQQQQLQKHQAELMLRKCNGGISLSFDNSSCTPTMSSTRSFVSSLSIDGSVANIEGKNSFHFGVPSSTDQNSLHSKRKCPLKGDEHGSLKCGSSSRCHCAKKRKHRVRRSIRVPAISNKVADIPPDDYSWRKYGQKPIKGSPYPRGYYKCSSMRGCPARKHVERCLEDPAMLIVTYEAEHNHPKLPSQAITT wrk39_arath Probable WRKY transcription factor 39 WRKY39 WRKY DNA-binding protein 39 F7O18.30 At3g04670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVEAANRSAIESCHGVLNLLSQRTSDPKSLTVETGEVVSKFKRVASLLTRGLGHGKFRSTNKFRSSFPQHIFLESPICCGNDLSGDYTQVLAPEPLQMVPASAVYNEMEPKHQLGHPSLMLSHKMCVDKSFLELKPPPFRAPYQLIHNHQQIAYSRSNSGVNLKFDGSGSSCYTPSVSNGSRSFVSSLSMDASVTDYDRNSFHLTGLSRGSDQQHTRKMCSGSLKCGSRSKCHCSKKRKLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHNHSRILSSQSAHT wrk74_arath Probable WRKY transcription factor 74 WRKY74 WRKY DNA-binding protein 74 F4I4.30 At5g28650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVEAANKAAVESCHGVLNLLSQQTNDSKSIMVETREAVCKFKRVSSLLSRGLGQRKIKKLNNNNYKFSSSLLPQHMFLESPVCSNNAISGCIPILAPKPLQIVPAGPPPLMLFNQNMCLDKSFLELKPPSSRAVDPKPYQFIHTHQQGVYSRSKSGLNLKFDGSIGASCYSPSISNGSRSFVSSLSMDGSVTDYDRNSFHLIGLPQGSDHISQHSRRTSCSGSLKCGSKSKCHCSKKRKLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVEETSMLIVTYEGEHNHSRILSSQSAHT q40828_petcr protein protein petcr Petroselinum crispum (Parsley) Petroselinum hortense MALDLMNNNSYKFRSKMEETAVQEAAAAGLQSVENLIKAISQSNHQTAYLSSSSSSETGDTDYRAVTDVAVNKFKKFISLLDKNRTGHARFRRGPVQEKTGVEMLVNPIQNQIQNHGSDGFQVYRPTAVHPVQPVQPVQIQPVQLVQPVQRLPPVPKKENISTTINFAAPAVAVAAPATSFMSSLTGDTDGSGFQITNMSGFSSGSRPVSSLKRKCSSMNDVSAKCSGSSSGRCHCPKKKKLRVKKVVRMPAISMKTSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAVDDPTMLIVTYEGEHNHSQSSNENTNTSHILESDGLKQS q9sxp4_tobac LOC107780047 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAVDFIGFSKMNEQLALQEAASAGLKSMEHLIRLVSHQQQQQPVQLDCREITDFTLSKFKKVVSILDRTGHARFRRGPVQVHPDNFTSLSLSPSNQQLLNLAPAKETPPPPSVSLPLTALTLDFTKPNVDRPTGNSNAIVAVKSKETFCISTPMATSANSSSFMSSITGEGSVSNGKQGSSVFLPPAPSVSAGKPPISGKRCREHEPSEDISGKSNGSGKCHCKKRKSRVKKVVRIPAISSRIADIPGDEYSWRKYGQKPIKGSPYPRGYYKCSSVRGCPARKHVERAMDDPAMLIVTYEGEHRHTIGAMQENNTQMMVFGSTEERRE q9fxs1_tobac NtEIG-D48 LOC107788966 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAVELMTSGYSRRDSFSTKMEENAVQEAATAGLQSVEKLIRLLSQSHQNQQQQQQKLDQNPSVSADYTAVADVAVNKFKKFISLLDKNRTGHARFRKGPISTPLPPPPKPQQQRLNQNSIKNQNLQIEETEKPQINTPKIYCPTPIQRLPPLPHNHLQLVKNGSIERKESSTTINFASASPANSFMSSLTGETESLQQSLSSGFQITNLSTVSSAGRPPLSTSSFKRKCSSMDDTALKCNSAGGSSGRCHCPKKRKSRVKRVVRVPAISMKMADIPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPTMLIVTYEGEHNHSHSITESPAAHVLESS cam2-wrky7-1 174093 n/a 174096 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 1 The authors concluded "the 17-amino acid stretch at the N-terminus of AtWRKY7, i.e., the C-region, (72VAVNSFKKVISLLGRSR88) may be its CaMBD" (Calmodulin binding domain) The interaction was calcium dependent. cam2-wrky7-3 174093 n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174096 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cbd region sufficient to bind sufficient binding region sufficient to bind electron resonance electron resonance certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 1 The authors concluded "the 17-amino acid stretch at the N-terminus of AtWRKY7, i.e., the C-region, (72VAVNSFKKVISLLGRSR88) may be its CaMBD" (Calmodulin binding domain) The interaction was calcium dependent. cam2-wrky7-4 174093 n/a 174096 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9STX0:p.Phe77Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9STX0:p.Leu84Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9STX0:p.[Phe77Arg;Leu84Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig 3 cam2-wrky11 174093 n/a 174098 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D cam2-wrky15 174093 n/a 174099 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D cam2-wrky17 174093 n/a 174100 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D cam2-wrky21 174093 n/a 174101 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D cam2-wrky39 174093 n/a 174102 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D The interaction was calcium dependent cam2-wrky74 174093 n/a 174103 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D cam2-wrky3 174093 n/a 174104 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D The interaction was calcium dependent. cam2-wrky3-1 174093 n/a 174105 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D The interaction was calcium dependent. cam2-subd48 174093 n/a 174097 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 174106 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5D The interaction was calcium dependent. cam2-wrky7 174094 n/a 174096 unspecified role unspecified role prey prey n/a 174097 unspecified role unspecified role bait bait region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cam2-wrky7-6 174095 n/a 174097 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 174096 unspecified role unspecified role bait bait Q9STX0:p.[Phe77Arg;Leu84Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4