IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yin-2005-2 A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yin Y., Vafeados D., Tao Y., Yoshida S., Asami T., Chory J. Figure 3 (c). chory@salk.edu Cell (0092-8674) 2005 yin-2005-1 A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yin Y., Vafeados D., Tao Y., Yoshida S., Asami T., Chory J. Figure 3 (c). chory@salk.edu Cell (0092-8674) 2005 bim1_arath Transcription factor BIM1 BES1-interacting Myc-like protein 1 Transcription factor EN 126 Basic helix-loop-helix protein 46 BIM1 EN126 At5g08130 T22D6.70 BHLH46 bHLH transcription factor bHLH046 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MELPQPRPFKTQGRKPTHDFLSLCSHSTVHPDPKPTPPPSSQGSHLKTHDFLQPLECVGAKEDVSRINSTTTASEKPPPPAPPPPLQHVLPGGIGTYTISPIPYFHHHHQRIPKPELSPPMMFNANERNVLDENSNSNCSSYAAASSGFTLWDESASGKKGQTRKENSVGERVNMRADVAATVGQWPVAERRSQSLTNNHMSGFSSLSSSQGSVLKSQSFMDMIRSAKGSSQEDDLDDEEDFIMKKESSSTSQSHRVDLRVKADVRGSPNDQKLNTPRSKHSATEQRRRSKINDRFQMLRQLIPNSDQKRDKASFLLEVIEYIQFLQEKADKYVTSYQGWNHEPAKLLNWQSNNNQQLVPEGVAFAPKLEEEKNNIPVSVLATAQGVVIDHPTTATTSPFPLSIQSNSFFSPVIAGNPVPQFHARVASSEAVEPSPSSRSQKEEEDEEVLEGNIRISSVYSQGLVKTLREALENSGVDLTKASISVEIELAKQSSSSSFKDHEVREPVSRTRNDNVKQTRKPKRLKTGQ bzr2_arath Protein BRASSINAZOLE-RESISTANT 2 BZR2 BES1 BIS1 At1g19350 F18O14_4 Protein BRI1-EMS-SUPPRESSOR 1 Protein BIN2 SUBSTRATE 1 Protein 107 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSDGATSTSAAAAAAAMATRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPLPGDMAGSSSRATPYSSHNQSPLSSTFDSPILSYQVSPSSSSFPSPSRVGDPHNISTIFPFLRNGGIPSSLPPLRISNSAPVTPPVSSPTSRNPKPLPTWESFTKQSMSMAAKQSMTSLNYPFYAVSAPASPTHHRQFHAPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQLSPNTAAIQEIGQSSEFKFENSQVKPWEGERIHDVAMEDLELTLGNGKAHS bim3_arath Transcription factor BIM3 BES1-interacting Myc-like protein 3 Transcription factor EN 127 Basic helix-loop-helix protein 141 BIM3 EN127 At5g38860 K15E6.7 K15E6.40 bHLH transcription factor bHLH141 BHLH141 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSHDIDDQLEADVYSNLPSRNDSSTGRRNRNSCRSKHSETEQRRRSKINERFQSLMDIIPQNQNDQKRDKASFLLEVIEYIHFLQEKVHMYEDSHQMWYQSPTKLIPWRNSHGSVAEENDHPQIVKSFSSNDKVAASSGFLLDTYNSVNPDIDSAVSTKIPEHSPVSAVSSYLRTEPSLQFVQHDFWQPKTSCGTINCFTNELLTSDEKTSASLSTVCSQRVLNTLTEALKSSGVNMSETMISVQLSLRKREDREYSVAAFASEDNGNSIADEEGDSPTETRSFCNDIDHSQKRIRR bes1-bim1-1 Pull down analysis reveals interaction between BES1 protein and the BIM1 transcription factor protein. 195467 N/A 195469 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 195470 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false bes1-bim3 Pull down analysis reveals interaction between BES1 protein and the BIM1 transcription factor protein. 195467 N/A 195471 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 195470 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false bes1-bim1 Yeast 2 hybrid analysis reveals interaction between BES1 protein and the BIM1 transcription factor protein. 195468 N/A 195469 unspecified role unspecified role prey prey N/A 195470 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false