IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ khanna-2004-1 A novel molecular recognition motif necessary for targeting photoactivated phytochrome signaling to specific basic helix-loop-helix transcription factors. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Khanna R., Huq E., Kikis EA., Al-Sady B., Lanzatella C., Quail PH. Figure 1 (a) to (c). Figure 4 (a) and (b). Figure 5 (a) and (b) quail@nature.berkeley.edu Plant Cell (1040-4651) 2004 phyb_arath Phytochrome B PHYB HY3 OOP1 Protein LONG HYPOCOTYL 3 Protein OUT OF PHASE 1 MSF3.17 At2g18790 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQPFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDVRSLFTSSSSILLERAFVAREITLLNPVWIHSKNTGKPFYAILHRIDVGVVIDLEPARTEDPALSIAGAVQSQKLAVRAISQLQALPGGDIKLLCDTVVESVRDLTGYDRVMVYKFHEDEHGEVVAESKRDDLEPYIGLHYPATDIPQASRFLFKQNRVRMIVDCNATPVLVVQDDRLTQSMCLVGSTLRAPHGCHSQYMANMGSIASLAMAVIINGNEDDGSNVASGRSSMRLWGLVVCHHTSSRCIPFPLRYACEFLMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRDSPAGIVTQSPSIMDLVKCDGAAFLYHGKYYPLGVAPSEVQIKDVVEWLLANHADSTGLSTDSLGDAGYPGAAALGDAVCGMAVAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFQAFLEVVKSRSQPWETAEMDAIHSLQLILRDSFKESEAAMNSKVVDGVVQPCRDMAGEQGIDELGAVAREMVRLIETATVPIFAVDAGGCINGWNAKIAELTGLSVEEAMGKSLVSDLIYKENEATVNKLLSRALRGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQKIVMDKFINIQGDYKAIVHSPNPLIPPIFAADENTCCLEWNMAMEKLTGWSRSEVIGKMIVGEVFGSCCMLKGPDALTKFMIVLHNAIGGQDTDKFPFPFFDRNGKFVQALLTANKRVSLEGKVIGAFCFLQIPSPELQQALAVQRRQDTECFTKAKELAYICQVIKNPLSGMRFANSLLEATDLNEDQKQLLETSVSCEKQISRIVGDMDLESIEDGSFVLKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPVPRKRPLSTASGSGDMMLMMPY pif5_arath Transcription factor PIF5 PIL6 Basic helix-loop-helix protein 65 Phytochrome interacting factor-like 6 F17J16.110 PIF5 EN103 Phytochrome-interacting factor 5 At3g59060 Transcription factor EN 103 BHLH65 bHLH transcription factor bHLH065 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQVFADWNFEDNFHMSTNKRSIRPEDELVELLWRDGQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALDDQETVSWIQYPPDDVIDPFESEFSSHFFSSIDHLGGPEKPRTIEETVKHEAQAMAPPKFRSSVITVGPSHCGSNQSTNIHQATTLPVSMSDRSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSVTIDRKRKHVMDADQESVSQSDIGLTSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTDKASILDEAIDYLKSLQMQLQVMWMGSGMAAAAAAAASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNRSAPQNHPGLVCQNPVQLQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADMLGFGSPAGPQSQLSAPATTDSLHMGKIG pif6_arath Transcription factor PIF6 PIF6 Transcription factor EN 111 bHLH transcription factor bHLH132 Basic helix-loop-helix protein 132 T17J13.50 At3g62090 BHLH132 EN111 PIL2 Protein PHYTOCHROME-INTERACTING FACTOR 6 Protein PHYTOCHROME INTERACTING FACTOR 3-LIKE 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMFLPTDYCCRLSDQEYMELVFENGQILAKGQRSNVSLHNQRTKSIMDLYEAEYNEDFMKSIIHGGGGAITNLGDTQVVPQSHVAAAHETNMLESNKHVDDSETLKASSSKRMMVDYHNRKKIKFIPPDEQSVVADRSFKLGFDTSSVGFTEDSEGSMYLSSSLDDESDDARPQVPARTRKALVKRKRNAEAYNSPERNQRNDINKKMRTLQNLLPNSHKDDNESMLDEAINYMTNLQLQVQMMTMGNRFVTPSMMMPLGPNYSQMGLAMGVGMQMGEQQFLPAHVLGAGLPGINDSADMLRFLNHPGLMPMQNSAPFIPTENCSPQSVPPSCAAFPNQIPNPNSLSNLDGATLHKKSRKTNR pif3_arath Transcription factor PIF3 Phytochrome-associated protein 3 Basic helix-loop-helix protein 8 PIF3 PAP3 BHLH8 At1g09530 F14J9.19 Transcription factor EN 100 bHLH transcription factor bHLH008 Phytochrome-interacting factor 3 EN100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLFELFRLTKAKLESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPPPQANSSRAREIGNGSKTTMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPSLDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLFQRRKDGNESAPAASSSQYNGFQSHSLYGSDRARDLPSQQTNPDRFTQTQEPLITSNKPSLVNFSHFLRPATFAKTTNNNLHDTKEKSPQSPPNVFQTRVLGAKDSEDKVLNESVASATPKDNQKACLISEDSCRKDQESEKAVVCSSVGSGNSLDGPSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQIMSMASGYYLPPAVMFPPGMGHYPAAAAAMAMGMGMPYAMGLPDLSRGGSSVNHGPQFQVSGMQQQPVAMGIPRVSGGGIFAGSSTIGNGSTRDLSGSKDQTTTNNNSNLKPIKRKQGSSDQFCGSS q8w2f3-2 Transcription factor PIF4 PIF4 BHLH9 EN102 SRL2 Basic helix-loop-helix protein 9 Phytochrome-interacting factor 4 Short under red-light 2 Transcription factor EN 102 bHLH transcription factor bHLH009 MFL8.13 At2g43010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERVLHRFVYIIYNI pif5-phyb Anti tag CoIP assay reveals in vivo interaction between PIF5 protein and the PHYB photoreceptor protein. 207110 N/A 207111 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 207112 unspecified role unspecified role bait bait gad tag GAL4 activation domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q84LH8:p.Glu31Ala Glutamine 31 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q84LH8:p.Leu32Ala Leucine 32 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q84LH8:p.Gly37Ala Glycine 37 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q84LH8:p.Gln38Ala Glutamine 38 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Pif5 preferentially interacted with the Pfr form of PHYB All listed amino acid alterations within the PIF5 protein abolished interaction with PHYB. pif6-phyb-1 Anti tag CoIP assay reveals in vivo interaction between PIF6 protein and the PHYB photoreceptor protein. 207110 N/A 207111 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 207113 unspecified role unspecified role bait bait gad tag GAL4 activation domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q8L5W7:p.[Glu19Ala;Gly25Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false PIF6 preferentially interacted with the Pfr form of PHYB. Alteration of amino acid sequence abolished interaction between PIF6 and PHYB. pif3-phyb-4 Anti tag coimmunoprecipitation reveals interaction between PIF3 protein and the PHYB photoreceptor protein 207110 N/A 207114 unspecified role unspecified role bait bait gal4 region GAL4 activation domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O80536:p.[Glu31Ala;Gly37Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 207111 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false PIF3 preferentially interacts with the Pfr (biologically active) form of PhyB Gyl 37 ala and glu 31 ala mutations abolished interaction between PIF4 and PHYB. pif4-phyb-2 Anti tag coimmunoprecipitation reveals interaction between PIF4 protein and the PHYB protein 207110 N/A 207111 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 207115 unspecified role unspecified role bait bait gad GAL4 activation domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q8W2F3-2:p.Gly35Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q8W2F3-2:p.[Glu29Ala;Gly35Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false PIF4 preferentially interacts with the Pfr (biologically active) form of PhyB Amino acid alterations to PIF4 abolished PIF4 interaction with PHYB.