IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hwang-2004-4 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 hwang-2004-5 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 hwang-2004-1 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 hwang-2004-2 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 hwang-2004-3 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 hwang-2004-6 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT trx-jab1-2 Coimmunoprecipitation reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184981 N/A 184987 unspecified role unspecified role prey prey N/A 184988 unspecified role unspecified role bait bait physical association physical association false false false jab1-trx Coimmunoprecipitation reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184981 N/A 184988 unspecified role unspecified role prey prey N/A 184987 unspecified role unspecified role bait bait physical association physical association false false false trx-jab1-5 Pulldown analysis reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184982 N/A 184988 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 184987 unspecified role unspecified role prey prey c terminal C terminal domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false trx-jab1-cdn1b Pulldown analysis reveals interaction between the cyclin-dependent kinase inhibitor 1B , thioredoxin and the COP9 signalosome complex subunit 5 protein 184982 N/A 184989 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 184988 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 184987 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false The authors note that Cyclin-dependent kinase inhibitor 1B and Thioredoxin compete for binding to the COP9 signalosome complex subunit 5 protein. trx-jab1 Yeast 2 hybrid analysis reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184983 N/A 184987 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 184988 unspecified role unspecified role bait bait P10599:p.Cys35Ser Cystiene35serine mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false trx-jab1-1 GST pulldown analysis reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184984 N/A 184987 unspecified role unspecified role prey prey s protein S protein tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184988 unspecified role unspecified role bait bait P10599:p.Cys35Ser Cystiene35serine mutation mutation certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false trx-jab1-4 GST pulldown analysis reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184985 N/A 184987 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184988 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P10599:p.Cys35Ser Cystiene35serine mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false trx-jab1-6 FRET analysis reveals interaction between thioredoxin and the COP9 signalosome complex subunit 5 protein 184986 N/A 184988 unspecified role unspecified role fluorescence donor fluorescence donor yfp yellow fluorescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 184987 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept rfp red florescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false