IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ becker-2004-2 Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.uni-muenchen.de schleiff@botanik.biologie.unimuenchen.de Mol. Biol. Cell (1059-1524) 2004 becker-2004-1 Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.uni-muenchen.de schleiff@botanik.biologie.unimuenchen.de Mol. Biol. Cell (1059-1524) 2004 becker-2004-3 Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.uni-muenchen.de schleiff@botanik.biologie.unimuenchen.de Mol. Biol. Cell (1059-1524) 2004 tic22_pea Protein TIC 22, chloroplastic TIC22 IAP25 Translocon at the inner envelope membrane of chloroplasts 22 protein protein pea Pisum sativum (Garden pea) Garden pea MESQGQWNPLLSFSRFINHHSNHLATRLEETKRLAGTLIQSHTRTKPAFAATLTPNHVAKSLAGTSVYTVSNSDNEFVLMSDAEGAKSIGLLCFRQEDAEAFLAQVRSRKKEFRGGAKVVPITLDQVYMLKVEGIAFRFLPDPVQIKNALELRAANRGSFDGVPVFQSDLLVVKKKNKRYCPVYFSKEDLEYELSKVSRSSKGVGVSQHIMVGSFEDVLKKMELSEKSSGWEDLVFIPPGKKHSQHMQEVIA q5qjd5_pea protein protein pea Pisum sativum (Garden pea) Garden pea MAATTTAGVIGGIGSGVSWMQFGRKEKKQNKMNTVTVCCSSYSSSVTDPYKILKVQPDASESDVRKAFRQLALQYHPDVCRGKDCDVQFHVINEAYVVSYYYL toc34_pea Translocase of chloroplast 34 34 kDa chloroplast outer envelope protein GTP-binding protein OEP34 GTP-binding protein IAP34 TOC34 IAP34 OEP34 protein protein pea Pisum sativum (Garden pea) Garden pea MASQQQTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEALIRRDIATETKPAWETRDVGDRK hsp7s_pea Stromal 70 kDa heat shock-related protein, chloroplastic HSP70 ST70 protein protein pea Pisum sativum (Garden pea) Garden pea MASSAQIHGLGTASFSSLKKPSSISGNSKTLFFGQRLNSNHSPFTRAAFPKLSSKTFKKGFTLRVVSEKVVGIDLGTTNSAVAAMEGGKPTIITNAEGQRTTPSVVAYTKNGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMSEVDEESKQVSYRVIRDDNGNVKLDCPAIGKSFAAEEISAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAGDFKRDEGIDLLKDKQALQRLTETAEKAKMELSSLSQTNISLPFITATADGPKHIETTLTRAKFEELCSDLLDRLRTPVENSLRDAKLSIKDIDEVILVGGSTRIPAVQELVKKLIGKDPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVSPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVERMVSEAERFSKEDKEKREAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLGELKEAITGGSTQTIKDALAALNQEVMQLGQSLYNQPGAAGQAGPTPPGSESGPSESSGKEGPEGDVIDADFTDSK toc64_pea Translocon at the outer membrane of chloroplasts 64 TOC64 protein protein pea Pisum sativum (Garden pea) Garden pea MKSMASPSSQIWVILGLGLAGIYVLTRKLTQAVKEDFGAFLLKLKLLPPPPPAPPKAPHPLSSLNFAISDIFDIEGHVSTFGHPEWARTHEPASSTASAVSALVESGATCIGTTVVDELAYGISGENKHFGTPTNPAVPNRVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGILGFRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGHILLQAPFVMQRNPRQIIIADDCFQHLNVPLDRTSQVVIKATEKLFGKQVLKHINFEDYISSKVSSLKACSIQKSNGVLKSSSLKLLANVMQSLQRHEFEHTHSEWMSIVKPDLHPAVSAQLHEKFEVSELEIENSKSVRSELRVAVNSLLKDEGVLVIPTVADPPPKLGGKEFLSHDYQSRALSLLSIASISGCCQVTVPLGFFDKNPVSVSLIARHGGDRFLLDTLKTMYTVLQEQADIAAPSKSSKSVVSKEQSAEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLFQ toc75_pea Protein TOC75, chloroplastic 75 kDa translocon at the outer-envelope membrane of chloroplasts Import intermediate-associated protein of 75 kDa 75 kDa chloroplast outer envelope protein TOC75 IAP75 OEP75 protein protein pea Pisum sativum (Garden pea) Garden pea MRTSVIPNRLTPTLTTHPSRRRNDHITTRTSSLKCHLSPSSGDNNDSFNSSLLKTISTTVAVSSAAASAFFLTGSLHSPFPNFSGLNAAAGGGAGGGGGGSSSSGGGGGGWFNGDEGSFWSRILSPARAIADEPKSEDWDSHELPADITVLLGRLSGFKKYKISDILFFDRNKKSKVETQDSFLDMVSLKPGGVYTKAQLQKELESLATCGMFEKVDMEGKTNADGSLGLTISFAESMWERADRFRCINVGLMGQSKPVEMDPDMSEKEKIEFFRRQEREYKRRISSARPCLLPTSVHEEIKDMLAEQGRVSARLLQKIRDRVQSWYHEEGYACAQVVNFGNLNTREVVCEVVEGDITKLSIQYLDKLGNVVEGNTEGPVVQRELPKQLLPGHTFNIEAGKQALRNINSLALFSNIEVNPRPDEMNEGSIIVEIKLKELEQKSAEVSTEWSIVPGRGGRPTLASLQPGGTITFEHRNLQGLNRSLTGSVTTSNFLNPQDDLAFKMEYAHPYLDGVDNPRNRTLRVSCFNSRKLSPVFTGGPGVDEVPSIWVDRAGVKANITENFSRQSKFTYGLVMEEIITRDESNHICSNGQRVLPNGAISADGPPTTLSGTGIDRMAFLQANITRDNTRFVNGTIVGSRNMFQVDQGLGVGSNFPFFNRHQLTVTKFLQLMSVEEGAGKSPPPVLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILELAAEIRIPIKGTHVYAFAEHGTDLGSSKDVKGNPTVVYRRMGQGSSYGAGMKLGLVRAEYAVDHNSGTGAVFFRFGERF q9lkr1_pea protein protein pea Pisum sativum (Garden pea) Garden pea MDSQTLSSSSQFHEPNNLLNGVNGHGSDSDSDDGFVSGEDEAEPSTPILVYDAKSTVQVKEKEEESFDQESPRPIAKVTADDEDEAEEEEDDSQGVGLEKEGGGGGGKDVEEVKEDEVFVEANDKGFESVDSEGGDVVGEEINNGLREEGDGGTEIETVRSDSVVVEPVSVDNSGVGVVENGDGVVDNEKLTSGGDFVVDSLRVNPLVDGGVAVVGDEVKDEVSEIDGAVAPAPVASLDNSFEAIEKVGSRSVVDEVGSSFETIEKGDEVVVDDEVVGGDVEPSKVVDSGVEIEVDDNVAHEQLSDVVLTEKAGDVVVDENVGVGAKPDEVVDIGVDEGVAQRQVSDIAPAEKGEEISEVVSQSLEAAEDEINIENRVVEGGIESRVVEGGIESRVDDAVEGEVGSNVVEVEDGSNVDNVAEKDAVSNVDDAAEKDAVSNVDRVVEVEDESHVGNTVEGEARSNADHVLQVEDETHLDNAAVGEAKSNADRVVEVEDETPLDNAAVGEAESNVDPAVKVEDDTRFDNGAEGEAESNVDRVGEVEDDTHFDNAVEEEAESNVDRVVEVEDDTHFDNAVEEEADSNVDRVIEMDDGSHVEAAVDHHIDREIDDLLSDSKDESMIFGGSDSANKYLEELEKQIRDSESSQGDRIDGQIVTDSDEEDVSDEEGGSKELFDTATLAALLKAASGAGGEDGGGITLTAQDGSRLFSVERPAGLGPSLQTGKPAVRSIRPNLFAPSMSRAGTVVSDTDLSEEDKKKLEKLQEIRIKYLRVIQRLGFTTEESIAAQVLYRLTLVAGRQIGEMFSLDAAKESASRLEAEGRDDFAFSLNILVLGKTGVGKSATINSIFGETKTSFSAYGPATTSVTEIVGMVDGVEIRVFDTPGLKSSAFEQSYNRKVLSTVKKLTKKSPPDIVLYVDRLDLQTRDMNDLPMLRSVTSALGPTIWRNVIVTLTHAASAPPDGPSGSPLSYDVFVAQRSHIVQQAIGQAVGDLRLMNPNLMNPVSLVENHPSCRKNRDGQKVLPNGQSWKPLLLLLCYSMKILSEATNISKTQEAADNRRLFGFRSRAPPLPYLLSWLLQSRAHPKLPDQAGIDNGDSDIEMADLSDSDGEEGEDEYDQLPPFKPLKKSQIAKLNGEQRKAYLEEYDYRVKLLQKKQWREELKRMRDMKKRGKNGENDYMEEDEENGSPAAVPVPLPDMVLPQSFDSDNPAYRYRFLEPNSQLLTRPVLDTHSWDHDCGYDGVNIENSMAIINKFPAAVTVQVTKDKQDFSIHLDSSVAAKHGENGSTMAGFDIQNIGKQLAYIVRGETKFKNFKRNKTAAGVSVTFLGENVSTGVKLEDQIALGKRLVLVGSTGTVRSQNDSAYGANVEVRLREADFPVGQDQSSLSLSLVQWRGDLALGANFQSQISLGRSYKMAVRAGLNNKLSGQINVRTSSSDQLQIALIAILPVAKAIYKNFWPGVTENYSIY toc complex-5 Pulldown assay reveals interaction between components of the Toc complex 209545 N/A 209548 unspecified role unspecified role prey prey N/A 209549 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 209550 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209551 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209552 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea association association false false false toc complex-6 Pull down assay reveals interaction components of the Toc complex 209545 N/A 209550 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209548 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209551 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209552 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 209552 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209549 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea association association false false false toc34-toc64 Pulldown assay reveals interaction components of the Toc complex, Toc64 and Toc34 proteins 209545 N/A 209552 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209550 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Authors specify the C-terminal region of the Toc34 protein as containing the interacting domain with Toc64. Co-ordinates of the C-terminal region not given in report. toc complex-7 Pulldown assay reveals components of the Toc complex. 209545 N/A 209552 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209548 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209549 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209548 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 209551 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea association association false false false toc complex-2 Affinity chromatograhy assay reveals components of the Toc complex. 209546 N/A 209553 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209550 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209552 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209549 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pea Pisum sativum (Garden pea) Garden pea association association false false false The presence of Tic22 was not tested here. In another assay using Toc 12 (residues 48 -103) the presence of Tic22 within a complex of Toc12, Toc34 and Toc64 was demonstrated. toc complex-3 Affinity chromatograhy assay reveals components of the Toc complex. 209546 N/A 209552 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209548 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209550 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209549 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pea Pisum sativum (Garden pea) Garden pea association association false false false The presenece of Toc75 was not tested for here. Toc75 had been shown to be present when full length Toc12 was used as bait in a previous assay. toc complex-4 Affinity chromatograhy assay reveals components of the Toc complex. 209546 N/A 209553 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209554 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209548 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209551 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209550 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209549 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea N/A 209552 unspecified role unspecified role bait bait pea Pisum sativum (Garden pea) Garden pea association association false false false toc64-hsp7s-2 Sucrose density gradient centrifugation assay reveals interaction between Toc64, HSP7S, Toc12 and Tic22 proteins 209547 N/A 209549 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea N/A 209548 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea N/A 209552 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea N/A 209551 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea physical association physical association false false false