MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ni-2004-3 Candida albicans Cdc37 interacts with the Crk1 kinase and is required for Crk1 production. yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ni J., Gao Y., Liu H., Chen J. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation ni-2004-1 Candida albicans Cdc37 interacts with the Crk1 kinase and is required for Crk1 production. yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Ni J., Gao Y., Liu H., Chen J. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation ni-2004-2 Candida albicans Cdc37 interacts with the Crk1 kinase and is required for Crk1 production. yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling predetermined predetermined participant predetermined Ni J., Gao Y., Liu H., Chen J. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation bur1_canal Serine/threonine-protein kinase BUR1 CRK1 BUR1 CaO19.3523/3524 CaO19.11006 CAALFM_C204930CA protein protein canal Candida albicans (strain SC5314 / ATCC MYA-2876) Yeast MSVIAGHHVPRSNDQRQYDTPSVPINIAPDSEGHIHEMSRLKDYEVIEKLGQGTFGVVQKAKSKKDGSLVAIKQLINHSAKEGFPITAMREITILKQLNHKNILTIQDMIFEEPKMSNRTDIITMRGSFYTVTPYMSSDLVGLLENPKIKLELGQIKCIMQQLLKGIQYVHNQKFLHRDIKAANILIGQDGVLKIADFGLARIYHGNVPRLGMGPGGGEKAYTGLVVTRWYRPPEILLGERKYTTAVDLWGIGCVFAELFTGKPILVGKSDSHQAQIVFELVGSPLTWTDAAKLPNKNEYSCGLACKRSLEAKFASIMPTEAIDLLSGLLTLDPFKRLNALDALNHKFFSTDPLPLLPTQMPKFEESHEIDKERFKKLKDKEQAVSELKPPTEIRYDNHSESRYNADHSTFGGGVGGKETSFSSGKSDYIDHYEPRARRDHYEPRIRNDNKDSNDVRGEFESATRQEQRRRDIQNRLDAGGMDTYIPKTTTAKLREHSGTESLSKKYDNYQPINVSRGSKSPSPSKLSSISQSKADLISKPSAPKVASRESSLERKQVSNGIRTTTDVEPPRARARRPTDMFGRPLTSNSTQAQPTRNKSVERPKDLEKPTNGVTEDRNKKPVLEEKKEVVKPNLAIPKIKKSSSLVSLSSRSSTTPVISNPSKVTKRAASSVTPPVLPKKPKISKTSSESEVSDLEEDSDFTGENATVFERFMALEQLQKSPVYKRIINEKMRFEKLSGGHKSM mint Serine/threonine-protein kinase involved in transcription regulation. Phosphorylates the UBC2/RAD6 ubiquitin-conjugating enzyme (E2), leading to monoubiquitination of histone H2B and the silencing of telomeric-associated genes. Also required for histone H3 methylation. Necessary for the recovery from pheromone-induced growth arrest in the cell cycle G1 phase (By similarity). Required for pseudohyphal growth and virulence in mice cdc37_canal Hsp90 co-chaperone Cdc37 CDC37 Hsp90 chaperone protein kinase-targeting subunit Cell division control protein 37 CaO19.5531 CAALFM_C602610CA protein protein canal Candida albicans (strain SC5314 / ATCC MYA-2876) Yeast MPIDYSKWDKIEISDDSDVEVHPNVDKQSFIRWKQRDIHEKRMQRNIEIKSILIQLTMYAKLNERVDYLLEKLTSTELLDSEKVMSKLNSEFDPQEKFDYDKLIKDKGSTLRKGLKDLKFDREEIENTPCYNEMIEDLFVQIKDDHPETKTDGDKLIEYLKEHRNRIDDVLSKQTIKLDDLLYQKAQLIVSDDLHTGFDRSFLNKDKPEEKEENQDKPKAPEAKKTTVTTTETINSPKPVEENTDKEILDELEILPATKEFAKIPSDNLSKAAEFLIKHPSICTEQQKDALIMTAFDLQLENKSDEAKHIVHQSLLLQYVGQLSDNGKAAPANVINAIKLFFSKIAAESSPAKHAFLEDVNQTFNHIKGRCEIIKEEQKQNAANKEGTGEEEEEEALIQLKALDDNTELSVNIPQEGTKEYEIFTTKLPIEFQNAIKTESIDEVNKEFAKLKIEDAERILEIFNECGVIGISGYIEDEKEFEELKKEYAHETANQEEDQSASVEDTVD mint Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity a0a1d8pn90_canal STI1 CAALFM_C501820WA orf19.3192 protein protein canal Candida albicans (strain SC5314 / ATCC MYA-2876) Yeast MTTADEYKAEGNKYFAAKDFEKAIEAFTKAIEASPEPNHVLYSNRSGSYASLKDFNNALKDAQECVKINPSWAKGYNRIAGAEFGLGNFDQAKSNYEKCLELDPNNAMAKEGLKSVESALASGGGDDKDLGFGKILNDPNLYTKLKNNPKTSEFMNDPQFVAKLERLKTNPQLGNPDMFSDPRLLTAFAALMGIDMDLPNMGFTAPNESQSNASEPKSEPKSVPESKPEPKAEQKEEESTSAKDEDTPMTDAQDDTNDNDAKTQADNAKAEGNALYKKRQFDEAIAAYNKAWELHKDITYLNNRAAAEYEKGDYDAAIATCEKAIDEGRDMRADYKLIAKSFARLGNIYLKKDELPEAVKNFEKSLTEHRTPDVLNKLRSTQREIKTRELNAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLLSFPDAIQDCNKAIEKDPNFIRAYIRKANAQLAMKEYSHVMDTLTEARTKDVELGGKSIHEIDELMNKATYQRFQAIEGETPEQTMERVSKDPEIVQILQDPVMQGILAQARENPAALQDHMKNPEVYKKINMLIAAGVIRTR mint cdc37-crk1-1 209465 bur1_canal 209468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc37_canal 209469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1B mint crk1-cdc37-1 209465 cdc37_canal 209469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 bur1_canal 209468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1B mint crk1-cdc37-2 209465 cdc37_canal 209469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 bur1_canal 209468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3B mint cdc37-crk1 209466 cdc37_canal 209469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 bur1_canal 209468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3A a weaker interaction is observed with full length crk1 mint cdc37-sti1 209466 cdc37_canal 209469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q59yx6_canal 209470 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F6 a weaker interaction is observed with full length Sti1 mint crk1-cdc37 209467 bur1_canal 209468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 cdc37_canal 209469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1A mint crk1-sti1 209467 bur1_canal 209468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 q59yx6_canal 209470 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F6 no interaction is observed with full length Sti1 mint